SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|568152611|ref|YP_008941564.1| from Pseudomonas aeruginosa LES431

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|568152611|ref|YP_008941564.1|
Domain Number 1 Region: 60-315
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like I 2.94e-52
Family L-arabinose binding protein-like 0.00027
Further Details:      
 
Domain Number 2 Region: 2-58
Classification Level Classification E-value
Superfamily lambda repressor-like DNA-binding domains 0.0000000000000122
Family GalR/LacI-like bacterial regulator 0.00073
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|568152611|ref|YP_008941564.1|
Sequence length 329
Comment transcriptional regulator [Pseudomonas aeruginosa LES431]
Sequence
MKLSDIARLAGVSVTTASYVINGKAAQRRISAATVERVLAVVEEHGYQPDQQAAGLRRGQ
TRTLGFILPDLENPSYARLAKQLEQGARARGYQLLIACSDDEPETERQVVNLFRARRCDA
LIVASCLPAGDDTHARLVAEGLPVVAIDRQLDPQRFASVISDDQDAARRLTETLLQPAPR
HIALLGARADLIISHDRAAGFRQALKDFRGEVIVEHAEVFSRECGRRLMEQLLERLGYLP
DALVTTAYVLLEGVFDVFQARADGWPEGLRVATFGDTQLLDFVPLKVNSIYQQHALIAAN
ALELALRAVEENDYRPGLHAVPRQLKLRD
Download sequence
Identical sequences A0A0C7CVU0 A0A0E1AUM2 A0A0H2ZEL0 A0A0H3R081 A0A157WIE2 A0A1C7BJT6 A0A1E9C4D9 A0A1F0IFE1 A0A1S1C8G2 Q9HY54 W1MGY9
gi|392982718|ref|YP_006481305.1| gi|386057490|ref|YP_005974012.1| gi|568152611|ref|YP_008941564.1| gi|478477595|ref|YP_007708246.1| gi|558673671|ref|YP_008810379.1| gi|15598759|ref|NP_252253.1| NP_252253.1.87394 WP_003104372.1.100071 WP_003104372.1.100100 WP_003104372.1.100179 WP_003104372.1.100278 WP_003104372.1.100319 WP_003104372.1.100394 WP_003104372.1.100420 WP_003104372.1.100469 WP_003104372.1.100473 WP_003104372.1.100523 WP_003104372.1.100654 WP_003104372.1.100723 WP_003104372.1.100742 WP_003104372.1.100777 WP_003104372.1.100786 WP_003104372.1.100808 WP_003104372.1.100809 WP_003104372.1.100810 WP_003104372.1.100872 WP_003104372.1.100983 WP_003104372.1.100995 WP_003104372.1.101021 WP_003104372.1.101047 WP_003104372.1.101090 WP_003104372.1.101269 WP_003104372.1.101340 WP_003104372.1.101506 WP_003104372.1.101590 WP_003104372.1.101642 WP_003104372.1.101712 WP_003104372.1.10174 WP_003104372.1.101781 WP_003104372.1.10179 WP_003104372.1.101809 WP_003104372.1.101863 WP_003104372.1.101871 WP_003104372.1.10202 WP_003104372.1.10204 WP_003104372.1.102045 WP_003104372.1.10228 WP_003104372.1.10248 WP_003104372.1.10271 WP_003104372.1.1037 WP_003104372.1.10407 WP_003104372.1.10419 WP_003104372.1.10457 WP_003104372.1.10468 WP_003104372.1.10477 WP_003104372.1.10482 WP_003104372.1.10513 WP_003104372.1.10529 WP_003104372.1.10548 WP_003104372.1.10572 WP_003104372.1.10575 WP_003104372.1.10636 WP_003104372.1.10641 WP_003104372.1.10856 WP_003104372.1.10895 WP_003104372.1.10901 WP_003104372.1.10949 WP_003104372.1.11026 WP_003104372.1.1107 WP_003104372.1.11077 WP_003104372.1.1109 WP_003104372.1.11130 WP_003104372.1.11163 WP_003104372.1.11178 WP_003104372.1.11318 WP_003104372.1.11381 WP_003104372.1.11388 WP_003104372.1.11410 WP_003104372.1.11417 WP_003104372.1.11454 WP_003104372.1.11568 WP_003104372.1.11569 WP_003104372.1.11653 WP_003104372.1.11744 WP_003104372.1.11754 WP_003104372.1.1180 WP_003104372.1.1183 WP_003104372.1.11847 WP_003104372.1.11854 WP_003104372.1.11943 WP_003104372.1.12081 WP_003104372.1.12120 WP_003104372.1.12150 WP_003104372.1.12208 WP_003104372.1.12240 WP_003104372.1.12302 WP_003104372.1.12354 WP_003104372.1.1238 WP_003104372.1.12400 WP_003104372.1.12482 WP_003104372.1.12530 WP_003104372.1.12547 WP_003104372.1.12657 WP_003104372.1.12660 WP_003104372.1.12687 WP_003104372.1.12744 WP_003104372.1.12797 WP_003104372.1.12838 WP_003104372.1.12873 WP_003104372.1.12891 WP_003104372.1.12922 WP_003104372.1.12930 WP_003104372.1.12934 WP_003104372.1.12970 WP_003104372.1.12980 WP_003104372.1.13 WP_003104372.1.13041 WP_003104372.1.1305 WP_003104372.1.13057 WP_003104372.1.13077 WP_003104372.1.13085 WP_003104372.1.13092 WP_003104372.1.13208 WP_003104372.1.13232 WP_003104372.1.13242 WP_003104372.1.13266 WP_003104372.1.13270 WP_003104372.1.13315 WP_003104372.1.1333 WP_003104372.1.13364 WP_003104372.1.13407 WP_003104372.1.13529 WP_003104372.1.13533 WP_003104372.1.1356 WP_003104372.1.1362 WP_003104372.1.13622 WP_003104372.1.13642 WP_003104372.1.13718 WP_003104372.1.13743 WP_003104372.1.13765 WP_003104372.1.13785 WP_003104372.1.13795 WP_003104372.1.13828 WP_003104372.1.13865 WP_003104372.1.1393 WP_003104372.1.14049 WP_003104372.1.14078 WP_003104372.1.14116 WP_003104372.1.14251 WP_003104372.1.14378 WP_003104372.1.14424 WP_003104372.1.14460 WP_003104372.1.14463 WP_003104372.1.14476 WP_003104372.1.14525 WP_003104372.1.14564 WP_003104372.1.14615 WP_003104372.1.14640 WP_003104372.1.14679 WP_003104372.1.14690 WP_003104372.1.14714 WP_003104372.1.1475 WP_003104372.1.14754 WP_003104372.1.14797 WP_003104372.1.14815 WP_003104372.1.14820 WP_003104372.1.14835 WP_003104372.1.14883 WP_003104372.1.14981 WP_003104372.1.15004 WP_003104372.1.15130 WP_003104372.1.152 WP_003104372.1.15222 WP_003104372.1.15231 WP_003104372.1.15281 WP_003104372.1.15297 WP_003104372.1.15328 WP_003104372.1.15373 WP_003104372.1.15408 WP_003104372.1.15474 WP_003104372.1.15480 WP_003104372.1.15485 WP_003104372.1.15602 WP_003104372.1.15606 WP_003104372.1.15666 WP_003104372.1.15692 WP_003104372.1.15886 WP_003104372.1.15889 WP_003104372.1.15934 WP_003104372.1.16041 WP_003104372.1.16074 WP_003104372.1.16109 WP_003104372.1.16161 WP_003104372.1.16197 WP_003104372.1.16239 WP_003104372.1.16242 WP_003104372.1.16267 WP_003104372.1.16279 WP_003104372.1.16419 WP_003104372.1.1646 WP_003104372.1.16660 WP_003104372.1.16694 WP_003104372.1.1670 WP_003104372.1.1671 WP_003104372.1.16751 WP_003104372.1.16782 WP_003104372.1.16788 WP_003104372.1.16801 WP_003104372.1.16811 WP_003104372.1.16895 WP_003104372.1.17022 WP_003104372.1.17108 WP_003104372.1.17155 WP_003104372.1.17162 WP_003104372.1.17177 WP_003104372.1.17189 WP_003104372.1.172 WP_003104372.1.17223 WP_003104372.1.17370 WP_003104372.1.1739 WP_003104372.1.17397 WP_003104372.1.17499 WP_003104372.1.17566 WP_003104372.1.1758 WP_003104372.1.1761 WP_003104372.1.17697 WP_003104372.1.17883 WP_003104372.1.17890 WP_003104372.1.18052 WP_003104372.1.18054 WP_003104372.1.18117 WP_003104372.1.18156 WP_003104372.1.18157 WP_003104372.1.18199 WP_003104372.1.18204 WP_003104372.1.18234 WP_003104372.1.1824 WP_003104372.1.18440 WP_003104372.1.18493 WP_003104372.1.18508 WP_003104372.1.18547 WP_003104372.1.18653 WP_003104372.1.18728 WP_003104372.1.18732 WP_003104372.1.18735 WP_003104372.1.18769 WP_003104372.1.18795 WP_003104372.1.18852 WP_003104372.1.18892 WP_003104372.1.18907 WP_003104372.1.18911 WP_003104372.1.18930 WP_003104372.1.190 WP_003104372.1.19089 WP_003104372.1.19199 WP_003104372.1.19251 WP_003104372.1.19269 WP_003104372.1.19346 WP_003104372.1.19351 WP_003104372.1.19376 WP_003104372.1.1938 WP_003104372.1.19552 WP_003104372.1.19591 WP_003104372.1.19640 WP_003104372.1.19703 WP_003104372.1.19711 WP_003104372.1.19718 WP_003104372.1.19741 WP_003104372.1.19771 WP_003104372.1.19803 WP_003104372.1.19824 WP_003104372.1.19930 WP_003104372.1.19931 WP_003104372.1.20024 WP_003104372.1.20070 WP_003104372.1.2012 WP_003104372.1.20125 WP_003104372.1.20134 WP_003104372.1.20154 WP_003104372.1.20216 WP_003104372.1.20590 WP_003104372.1.20682 WP_003104372.1.20692 WP_003104372.1.20744 WP_003104372.1.20764 WP_003104372.1.20825 WP_003104372.1.20880 WP_003104372.1.20884 WP_003104372.1.20890 WP_003104372.1.209 WP_003104372.1.20929 WP_003104372.1.20978 WP_003104372.1.21002 WP_003104372.1.21096 WP_003104372.1.21100 WP_003104372.1.21166 WP_003104372.1.21209 WP_003104372.1.21242 WP_003104372.1.21253 WP_003104372.1.21302 WP_003104372.1.21349 WP_003104372.1.2144 WP_003104372.1.21448 WP_003104372.1.21460 WP_003104372.1.21469 WP_003104372.1.21471 WP_003104372.1.21517 WP_003104372.1.21607 WP_003104372.1.21718 WP_003104372.1.2172 WP_003104372.1.21744 WP_003104372.1.21782 WP_003104372.1.21801 WP_003104372.1.21871 WP_003104372.1.21891 WP_003104372.1.21932 WP_003104372.1.22078 WP_003104372.1.221 WP_003104372.1.2228 WP_003104372.1.22316 WP_003104372.1.22324 WP_003104372.1.22365 WP_003104372.1.2237 WP_003104372.1.22389 WP_003104372.1.22390 WP_003104372.1.22394 WP_003104372.1.22442 WP_003104372.1.22477 WP_003104372.1.22491 WP_003104372.1.22573 WP_003104372.1.22671 WP_003104372.1.22704 WP_003104372.1.22729 WP_003104372.1.22863 WP_003104372.1.2289 WP_003104372.1.22891 WP_003104372.1.23013 WP_003104372.1.23166 WP_003104372.1.23191 WP_003104372.1.23195 WP_003104372.1.2323 WP_003104372.1.23264 WP_003104372.1.23418 WP_003104372.1.23421 WP_003104372.1.23512 WP_003104372.1.23525 WP_003104372.1.23581 WP_003104372.1.236 WP_003104372.1.23641 WP_003104372.1.23739 WP_003104372.1.23769 WP_003104372.1.23782 WP_003104372.1.23794 WP_003104372.1.23884 WP_003104372.1.23925 WP_003104372.1.23961 WP_003104372.1.23967 WP_003104372.1.23983 WP_003104372.1.24066 WP_003104372.1.24077 WP_003104372.1.24087 WP_003104372.1.24183 WP_003104372.1.24234 WP_003104372.1.24351 WP_003104372.1.24413 WP_003104372.1.24447 WP_003104372.1.24626 WP_003104372.1.2477 WP_003104372.1.24851 WP_003104372.1.24862 WP_003104372.1.24869 WP_003104372.1.24879 WP_003104372.1.24938 WP_003104372.1.24940 WP_003104372.1.25033 WP_003104372.1.25052 WP_003104372.1.25067 WP_003104372.1.251 WP_003104372.1.2511 WP_003104372.1.25142 WP_003104372.1.25149 WP_003104372.1.25191 WP_003104372.1.25271 WP_003104372.1.2529 WP_003104372.1.2530 WP_003104372.1.25328 WP_003104372.1.25344 WP_003104372.1.25348 WP_003104372.1.2535 WP_003104372.1.25477 WP_003104372.1.25532 WP_003104372.1.25600 WP_003104372.1.25641 WP_003104372.1.25675 WP_003104372.1.2572 WP_003104372.1.25834 WP_003104372.1.25903 WP_003104372.1.25964 WP_003104372.1.26010 WP_003104372.1.26025 WP_003104372.1.26042 WP_003104372.1.261 WP_003104372.1.26159 WP_003104372.1.26301 WP_003104372.1.26334 WP_003104372.1.26489 WP_003104372.1.26539 WP_003104372.1.26604 WP_003104372.1.26681 WP_003104372.1.26682 WP_003104372.1.26705 WP_003104372.1.26816 WP_003104372.1.26862 WP_003104372.1.26967 WP_003104372.1.27018 WP_003104372.1.27028 WP_003104372.1.27039 WP_003104372.1.27073 WP_003104372.1.27107 WP_003104372.1.27211 WP_003104372.1.27218 WP_003104372.1.27259 WP_003104372.1.27288 WP_003104372.1.27505 WP_003104372.1.27534 WP_003104372.1.27549 WP_003104372.1.27575 WP_003104372.1.27587 WP_003104372.1.27687 WP_003104372.1.27738 WP_003104372.1.27772 WP_003104372.1.27825 WP_003104372.1.27837 WP_003104372.1.27858 WP_003104372.1.27939 WP_003104372.1.27966 WP_003104372.1.28006 WP_003104372.1.28064 WP_003104372.1.28078 WP_003104372.1.28136 WP_003104372.1.28175 WP_003104372.1.28193 WP_003104372.1.283 WP_003104372.1.28316 WP_003104372.1.28372 WP_003104372.1.28383 WP_003104372.1.28404 WP_003104372.1.28468 WP_003104372.1.28505 WP_003104372.1.28560 WP_003104372.1.28602 WP_003104372.1.28623 WP_003104372.1.28699 WP_003104372.1.28713 WP_003104372.1.28757 WP_003104372.1.28823 WP_003104372.1.28838 WP_003104372.1.28849 WP_003104372.1.28878 WP_003104372.1.28920 WP_003104372.1.29003 WP_003104372.1.29008 WP_003104372.1.29062 WP_003104372.1.29070 WP_003104372.1.29127 WP_003104372.1.29137 WP_003104372.1.29158 WP_003104372.1.29179 WP_003104372.1.29208 WP_003104372.1.2927 WP_003104372.1.29401 WP_003104372.1.2941 WP_003104372.1.29438 WP_003104372.1.29440 WP_003104372.1.29472 WP_003104372.1.29481 WP_003104372.1.29498 WP_003104372.1.29501 WP_003104372.1.29577 WP_003104372.1.29633 WP_003104372.1.29650 WP_003104372.1.29668 WP_003104372.1.2980 WP_003104372.1.29848 WP_003104372.1.29920 WP_003104372.1.29958 WP_003104372.1.29973 WP_003104372.1.30000 WP_003104372.1.30020 WP_003104372.1.30081 WP_003104372.1.30254 WP_003104372.1.3030 WP_003104372.1.30365 WP_003104372.1.30474 WP_003104372.1.30475 WP_003104372.1.30563 WP_003104372.1.30567 WP_003104372.1.30614 WP_003104372.1.30615 WP_003104372.1.30625 WP_003104372.1.30693 WP_003104372.1.30707 WP_003104372.1.3072 WP_003104372.1.30740 WP_003104372.1.30797 WP_003104372.1.30815 WP_003104372.1.30842 WP_003104372.1.30886 WP_003104372.1.30943 WP_003104372.1.30973 WP_003104372.1.30994 WP_003104372.1.31045 WP_003104372.1.31076 WP_003104372.1.31087 WP_003104372.1.31105 WP_003104372.1.31138 WP_003104372.1.31147 WP_003104372.1.31279 WP_003104372.1.31361 WP_003104372.1.31457 WP_003104372.1.31563 WP_003104372.1.31565 WP_003104372.1.31587 WP_003104372.1.31633 WP_003104372.1.31655 WP_003104372.1.31732 WP_003104372.1.31751 WP_003104372.1.3179 WP_003104372.1.31848 WP_003104372.1.31852 WP_003104372.1.3189 WP_003104372.1.319 WP_003104372.1.31939 WP_003104372.1.32134 WP_003104372.1.32137 WP_003104372.1.32235 WP_003104372.1.32289 WP_003104372.1.32359 WP_003104372.1.32523 WP_003104372.1.32544 WP_003104372.1.32596 WP_003104372.1.32711 WP_003104372.1.32869 WP_003104372.1.32879 WP_003104372.1.32998 WP_003104372.1.33009 WP_003104372.1.33047 WP_003104372.1.33097 WP_003104372.1.33133 WP_003104372.1.33152 WP_003104372.1.33186 WP_003104372.1.33204 WP_003104372.1.33210 WP_003104372.1.33216 WP_003104372.1.33294 WP_003104372.1.33340 WP_003104372.1.33387 WP_003104372.1.33438 WP_003104372.1.33455 WP_003104372.1.3351 WP_003104372.1.33517 WP_003104372.1.33521 WP_003104372.1.33523 WP_003104372.1.33658 WP_003104372.1.33669 WP_003104372.1.3368 WP_003104372.1.33728 WP_003104372.1.33733 WP_003104372.1.33734 WP_003104372.1.3376 WP_003104372.1.33774 WP_003104372.1.33801 WP_003104372.1.33814 WP_003104372.1.33822 WP_003104372.1.33824 WP_003104372.1.33833 WP_003104372.1.3385 WP_003104372.1.33945 WP_003104372.1.34000 WP_003104372.1.34039 WP_003104372.1.34136 WP_003104372.1.34143 WP_003104372.1.34150 WP_003104372.1.34151 WP_003104372.1.34180 WP_003104372.1.34191 WP_003104372.1.34203 WP_003104372.1.34306 WP_003104372.1.34317 WP_003104372.1.34324 WP_003104372.1.3436 WP_003104372.1.34401 WP_003104372.1.34402 WP_003104372.1.34461 WP_003104372.1.34472 WP_003104372.1.34556 WP_003104372.1.34583 WP_003104372.1.34625 WP_003104372.1.34670 WP_003104372.1.34784 WP_003104372.1.34821 WP_003104372.1.34832 WP_003104372.1.34836 WP_003104372.1.34837 WP_003104372.1.34876 WP_003104372.1.34901 WP_003104372.1.34922 WP_003104372.1.34942 WP_003104372.1.35149 WP_003104372.1.35231 WP_003104372.1.35281 WP_003104372.1.35325 WP_003104372.1.35353 WP_003104372.1.3540 WP_003104372.1.35431 WP_003104372.1.35442 WP_003104372.1.35480 WP_003104372.1.35512 WP_003104372.1.35529 WP_003104372.1.3555 WP_003104372.1.35599 WP_003104372.1.35639 WP_003104372.1.35641 WP_003104372.1.35669 WP_003104372.1.35679 WP_003104372.1.3568 WP_003104372.1.35682 WP_003104372.1.3576 WP_003104372.1.35762 WP_003104372.1.35768 WP_003104372.1.35822 WP_003104372.1.35843 WP_003104372.1.35857 WP_003104372.1.35872 WP_003104372.1.35968 WP_003104372.1.35984 WP_003104372.1.36064 WP_003104372.1.36121 WP_003104372.1.36148 WP_003104372.1.36266 WP_003104372.1.36267 WP_003104372.1.36285 WP_003104372.1.36378 WP_003104372.1.36487 WP_003104372.1.36521 WP_003104372.1.3653 WP_003104372.1.36587 WP_003104372.1.36608 WP_003104372.1.3662 WP_003104372.1.36630 WP_003104372.1.36665 WP_003104372.1.36708 WP_003104372.1.3672 WP_003104372.1.36781 WP_003104372.1.37050 WP_003104372.1.37097 WP_003104372.1.37163 WP_003104372.1.37172 WP_003104372.1.37208 WP_003104372.1.3721 WP_003104372.1.37216 WP_003104372.1.373 WP_003104372.1.37319 WP_003104372.1.37366 WP_003104372.1.37416 WP_003104372.1.3742 WP_003104372.1.37500 WP_003104372.1.37512 WP_003104372.1.37571 WP_003104372.1.3768 WP_003104372.1.37698 WP_003104372.1.3773 WP_003104372.1.3781 WP_003104372.1.37814 WP_003104372.1.37818 WP_003104372.1.37826 WP_003104372.1.37842 WP_003104372.1.3785 WP_003104372.1.3792 WP_003104372.1.38003 WP_003104372.1.38023 WP_003104372.1.38060 WP_003104372.1.38087 WP_003104372.1.38102 WP_003104372.1.38146 WP_003104372.1.38151 WP_003104372.1.3818 WP_003104372.1.38186 WP_003104372.1.3821 WP_003104372.1.38319 WP_003104372.1.3833 WP_003104372.1.38335 WP_003104372.1.38337 WP_003104372.1.38406 WP_003104372.1.38450 WP_003104372.1.38502 WP_003104372.1.38505 WP_003104372.1.38510 WP_003104372.1.38582 WP_003104372.1.38583 WP_003104372.1.38587 WP_003104372.1.38657 WP_003104372.1.38661 WP_003104372.1.3870 WP_003104372.1.38706 WP_003104372.1.38727 WP_003104372.1.38816 WP_003104372.1.38834 WP_003104372.1.3887 WP_003104372.1.38889 WP_003104372.1.38932 WP_003104372.1.38971 WP_003104372.1.39046 WP_003104372.1.39088 WP_003104372.1.39122 WP_003104372.1.39186 WP_003104372.1.39271 WP_003104372.1.39345 WP_003104372.1.3943 WP_003104372.1.39444 WP_003104372.1.39458 WP_003104372.1.39537 WP_003104372.1.39704 WP_003104372.1.39765 WP_003104372.1.39786 WP_003104372.1.39811 WP_003104372.1.39920 WP_003104372.1.39949 WP_003104372.1.3998 WP_003104372.1.39989 WP_003104372.1.40059 WP_003104372.1.40135 WP_003104372.1.40213 WP_003104372.1.40237 WP_003104372.1.40243 WP_003104372.1.40271 WP_003104372.1.40419 WP_003104372.1.40442 WP_003104372.1.40512 WP_003104372.1.40513 WP_003104372.1.40541 WP_003104372.1.40546 WP_003104372.1.40595 WP_003104372.1.40703 WP_003104372.1.40874 WP_003104372.1.40984 WP_003104372.1.40993 WP_003104372.1.40994 WP_003104372.1.41110 WP_003104372.1.41137 WP_003104372.1.41199 WP_003104372.1.41291 WP_003104372.1.41301 WP_003104372.1.41384 WP_003104372.1.41412 WP_003104372.1.41429 WP_003104372.1.41487 WP_003104372.1.41492 WP_003104372.1.41502 WP_003104372.1.4156 WP_003104372.1.41618 WP_003104372.1.41624 WP_003104372.1.41625 WP_003104372.1.41692 WP_003104372.1.41703 WP_003104372.1.41725 WP_003104372.1.41732 WP_003104372.1.41748 WP_003104372.1.41773 WP_003104372.1.41832 WP_003104372.1.41846 WP_003104372.1.41871 WP_003104372.1.41888 WP_003104372.1.4190 WP_003104372.1.41939 WP_003104372.1.4196 WP_003104372.1.42 WP_003104372.1.42047 WP_003104372.1.42146 WP_003104372.1.42259 WP_003104372.1.42294 WP_003104372.1.42316 WP_003104372.1.42388 WP_003104372.1.42411 WP_003104372.1.42423 WP_003104372.1.42463 WP_003104372.1.42499 WP_003104372.1.42634 WP_003104372.1.42690 WP_003104372.1.42696 WP_003104372.1.42723 WP_003104372.1.4273 WP_003104372.1.42754 WP_003104372.1.42757 WP_003104372.1.42778 WP_003104372.1.42854 WP_003104372.1.42856 WP_003104372.1.42870 WP_003104372.1.42917 WP_003104372.1.42946 WP_003104372.1.42952 WP_003104372.1.42972 WP_003104372.1.42973 WP_003104372.1.43022 WP_003104372.1.43024 WP_003104372.1.43026 WP_003104372.1.43106 WP_003104372.1.43107 WP_003104372.1.43212 WP_003104372.1.43286 WP_003104372.1.43293 WP_003104372.1.43315 WP_003104372.1.43326 WP_003104372.1.43330 WP_003104372.1.43356 WP_003104372.1.4348 WP_003104372.1.43593 WP_003104372.1.43662 WP_003104372.1.43667 WP_003104372.1.43673 WP_003104372.1.43729 WP_003104372.1.43756 WP_003104372.1.43783 WP_003104372.1.43802 WP_003104372.1.4381 WP_003104372.1.43811 WP_003104372.1.43826 WP_003104372.1.4397 WP_003104372.1.4398 WP_003104372.1.43998 WP_003104372.1.44046 WP_003104372.1.44094 WP_003104372.1.44213 WP_003104372.1.44260 WP_003104372.1.44269 WP_003104372.1.44373 WP_003104372.1.44486 WP_003104372.1.445 WP_003104372.1.44552 WP_003104372.1.44563 WP_003104372.1.44565 WP_003104372.1.44581 WP_003104372.1.44725 WP_003104372.1.44739 WP_003104372.1.44760 WP_003104372.1.44804 WP_003104372.1.44870 WP_003104372.1.4493 WP_003104372.1.44959 WP_003104372.1.45063 WP_003104372.1.45090 WP_003104372.1.45146 WP_003104372.1.45199 WP_003104372.1.45202 WP_003104372.1.4522 WP_003104372.1.45298 WP_003104372.1.4532 WP_003104372.1.45328 WP_003104372.1.45353 WP_003104372.1.45464 WP_003104372.1.45478 WP_003104372.1.45485 WP_003104372.1.45604 WP_003104372.1.45611 WP_003104372.1.45635 WP_003104372.1.45678 WP_003104372.1.45723 WP_003104372.1.45837 WP_003104372.1.45920 WP_003104372.1.45934 WP_003104372.1.45946 WP_003104372.1.45961 WP_003104372.1.46010 WP_003104372.1.46032 WP_003104372.1.46093 WP_003104372.1.461 WP_003104372.1.46152 WP_003104372.1.46200 WP_003104372.1.46306 WP_003104372.1.4640 WP_003104372.1.46436 WP_003104372.1.46502 WP_003104372.1.46623 WP_003104372.1.46633 WP_003104372.1.46755 WP_003104372.1.46787 WP_003104372.1.46826 WP_003104372.1.46846 WP_003104372.1.46866 WP_003104372.1.46926 WP_003104372.1.46935 WP_003104372.1.4699 WP_003104372.1.47101 WP_003104372.1.47150 WP_003104372.1.47155 WP_003104372.1.47158 WP_003104372.1.47251 WP_003104372.1.4726 WP_003104372.1.47296 WP_003104372.1.47312 WP_003104372.1.47314 WP_003104372.1.47374 WP_003104372.1.47469 WP_003104372.1.47527 WP_003104372.1.47551 WP_003104372.1.47598 WP_003104372.1.47645 WP_003104372.1.47774 WP_003104372.1.47934 WP_003104372.1.47970 WP_003104372.1.48001 WP_003104372.1.48024 WP_003104372.1.48086 WP_003104372.1.48141 WP_003104372.1.48172 WP_003104372.1.48178 WP_003104372.1.48334 WP_003104372.1.48378 WP_003104372.1.48382 WP_003104372.1.48413 WP_003104372.1.48472 WP_003104372.1.48545 WP_003104372.1.48576 WP_003104372.1.48579 WP_003104372.1.48747 WP_003104372.1.48810 WP_003104372.1.48820 WP_003104372.1.48840 WP_003104372.1.48842 WP_003104372.1.48851 WP_003104372.1.48870 WP_003104372.1.48961 WP_003104372.1.49108 WP_003104372.1.49135 WP_003104372.1.49184 WP_003104372.1.49244 WP_003104372.1.49265 WP_003104372.1.49266 WP_003104372.1.49277 WP_003104372.1.49286 WP_003104372.1.49293 WP_003104372.1.49360 WP_003104372.1.49416 WP_003104372.1.49500 WP_003104372.1.49557 WP_003104372.1.49566 WP_003104372.1.49688 WP_003104372.1.49798 WP_003104372.1.49806 WP_003104372.1.49833 WP_003104372.1.49842 WP_003104372.1.49922 WP_003104372.1.49948 WP_003104372.1.49976 WP_003104372.1.49988 WP_003104372.1.49998 WP_003104372.1.50176 WP_003104372.1.50180 WP_003104372.1.50222 WP_003104372.1.50232 WP_003104372.1.50242 WP_003104372.1.5043 WP_003104372.1.50450 WP_003104372.1.50459 WP_003104372.1.50567 WP_003104372.1.50653 WP_003104372.1.50665 WP_003104372.1.50668 WP_003104372.1.50682 WP_003104372.1.50691 WP_003104372.1.50734 WP_003104372.1.50783 WP_003104372.1.50814 WP_003104372.1.50922 WP_003104372.1.50967 WP_003104372.1.50989 WP_003104372.1.51019 WP_003104372.1.51035 WP_003104372.1.51136 WP_003104372.1.51141 WP_003104372.1.51173 WP_003104372.1.51183 WP_003104372.1.51267 WP_003104372.1.51273 WP_003104372.1.51457 WP_003104372.1.51472 WP_003104372.1.51501 WP_003104372.1.51538 WP_003104372.1.51549 WP_003104372.1.51585 WP_003104372.1.51682 WP_003104372.1.51727 WP_003104372.1.51733 WP_003104372.1.51807 WP_003104372.1.51847 WP_003104372.1.51889 WP_003104372.1.51928 WP_003104372.1.51943 WP_003104372.1.51957 WP_003104372.1.51976 WP_003104372.1.52146 WP_003104372.1.52152 WP_003104372.1.52220 WP_003104372.1.5226 WP_003104372.1.52326 WP_003104372.1.52334 WP_003104372.1.5235 WP_003104372.1.52355 WP_003104372.1.52372 WP_003104372.1.52403 WP_003104372.1.52409 WP_003104372.1.52500 WP_003104372.1.52537 WP_003104372.1.5258 WP_003104372.1.52583 WP_003104372.1.52591 WP_003104372.1.5260 WP_003104372.1.52690 WP_003104372.1.52697 WP_003104372.1.52700 WP_003104372.1.52728 WP_003104372.1.52784 WP_003104372.1.52810 WP_003104372.1.52850 WP_003104372.1.5289 WP_003104372.1.52939 WP_003104372.1.5294 WP_003104372.1.53070 WP_003104372.1.53072 WP_003104372.1.53169 WP_003104372.1.53267 WP_003104372.1.53287 WP_003104372.1.53371 WP_003104372.1.53427 WP_003104372.1.53486 WP_003104372.1.53530 WP_003104372.1.53586 WP_003104372.1.53663 WP_003104372.1.53678 WP_003104372.1.53719 WP_003104372.1.53726 WP_003104372.1.53826 WP_003104372.1.53932 WP_003104372.1.53946 WP_003104372.1.53948 WP_003104372.1.53951 WP_003104372.1.5399 WP_003104372.1.54003 WP_003104372.1.54076 WP_003104372.1.54078 WP_003104372.1.54090 WP_003104372.1.54133 WP_003104372.1.54140 WP_003104372.1.54146 WP_003104372.1.5420 WP_003104372.1.54293 WP_003104372.1.54354 WP_003104372.1.54462 WP_003104372.1.54497 WP_003104372.1.54571 WP_003104372.1.54742 WP_003104372.1.54809 WP_003104372.1.54974 WP_003104372.1.55 WP_003104372.1.55169 WP_003104372.1.55318 WP_003104372.1.55347 WP_003104372.1.55387 WP_003104372.1.55478 WP_003104372.1.55543 WP_003104372.1.55813 WP_003104372.1.55976 WP_003104372.1.56171 WP_003104372.1.56187 WP_003104372.1.56188 WP_003104372.1.56196 WP_003104372.1.56229 WP_003104372.1.56315 WP_003104372.1.56348 WP_003104372.1.56442 WP_003104372.1.56452 WP_003104372.1.56465 WP_003104372.1.56474 WP_003104372.1.56623 WP_003104372.1.56626 WP_003104372.1.56632 WP_003104372.1.56745 WP_003104372.1.56768 WP_003104372.1.56797 WP_003104372.1.56808 WP_003104372.1.56819 WP_003104372.1.56837 WP_003104372.1.56864 WP_003104372.1.56896 WP_003104372.1.56973 WP_003104372.1.57005 WP_003104372.1.57020 WP_003104372.1.57113 WP_003104372.1.57131 WP_003104372.1.57140 WP_003104372.1.57276 WP_003104372.1.5731 WP_003104372.1.57369 WP_003104372.1.57460 WP_003104372.1.57477 WP_003104372.1.57480 WP_003104372.1.57532 WP_003104372.1.57548 WP_003104372.1.57566 WP_003104372.1.57728 WP_003104372.1.57792 WP_003104372.1.57839 WP_003104372.1.57841 WP_003104372.1.57853 WP_003104372.1.57921 WP_003104372.1.57966 WP_003104372.1.58019 WP_003104372.1.58155 WP_003104372.1.58162 WP_003104372.1.58183 WP_003104372.1.58193 WP_003104372.1.58200 WP_003104372.1.58228 WP_003104372.1.58294 WP_003104372.1.58360 WP_003104372.1.58417 WP_003104372.1.58482 WP_003104372.1.5850 WP_003104372.1.58510 WP_003104372.1.58527 WP_003104372.1.58689 WP_003104372.1.5869 WP_003104372.1.58785 WP_003104372.1.58800 WP_003104372.1.58838 WP_003104372.1.58845 WP_003104372.1.5889 WP_003104372.1.58944 WP_003104372.1.58952 WP_003104372.1.5897 WP_003104372.1.59013 WP_003104372.1.59076 WP_003104372.1.59099 WP_003104372.1.59156 WP_003104372.1.59158 WP_003104372.1.59176 WP_003104372.1.59212 WP_003104372.1.59246 WP_003104372.1.59249 WP_003104372.1.59288 WP_003104372.1.59339 WP_003104372.1.5937 WP_003104372.1.59376 WP_003104372.1.59385 WP_003104372.1.594 WP_003104372.1.59469 WP_003104372.1.59563 WP_003104372.1.59688 WP_003104372.1.59724 WP_003104372.1.59759 WP_003104372.1.59797 WP_003104372.1.59831 WP_003104372.1.59870 WP_003104372.1.59943 WP_003104372.1.60051 WP_003104372.1.60062 WP_003104372.1.60079 WP_003104372.1.60082 WP_003104372.1.60084 WP_003104372.1.60085 WP_003104372.1.60206 WP_003104372.1.60261 WP_003104372.1.60347 WP_003104372.1.60364 WP_003104372.1.60396 WP_003104372.1.60415 WP_003104372.1.60467 WP_003104372.1.60472 WP_003104372.1.60509 WP_003104372.1.60600 WP_003104372.1.60602 WP_003104372.1.60603 WP_003104372.1.60679 WP_003104372.1.60686 WP_003104372.1.607 WP_003104372.1.60850 WP_003104372.1.60916 WP_003104372.1.60970 WP_003104372.1.61122 WP_003104372.1.61130 WP_003104372.1.61191 WP_003104372.1.61209 WP_003104372.1.61222 WP_003104372.1.61288 WP_003104372.1.61294 WP_003104372.1.61299 WP_003104372.1.6130 WP_003104372.1.61366 WP_003104372.1.61549 WP_003104372.1.61589 WP_003104372.1.61598 WP_003104372.1.616 WP_003104372.1.61696 WP_003104372.1.6173 WP_003104372.1.61943 WP_003104372.1.62010 WP_003104372.1.62186 WP_003104372.1.62211 WP_003104372.1.62357 WP_003104372.1.62396 WP_003104372.1.62410 WP_003104372.1.6242 WP_003104372.1.62483 WP_003104372.1.62516 WP_003104372.1.62534 WP_003104372.1.626 WP_003104372.1.62604 WP_003104372.1.62688 WP_003104372.1.62701 WP_003104372.1.62703 WP_003104372.1.62704 WP_003104372.1.62768 WP_003104372.1.62772 WP_003104372.1.6283 WP_003104372.1.62834 WP_003104372.1.62838 WP_003104372.1.62873 WP_003104372.1.62917 WP_003104372.1.62961 WP_003104372.1.63041 WP_003104372.1.63124 WP_003104372.1.63193 WP_003104372.1.63196 WP_003104372.1.63338 WP_003104372.1.63369 WP_003104372.1.63401 WP_003104372.1.63591 WP_003104372.1.63597 WP_003104372.1.63634 WP_003104372.1.63659 WP_003104372.1.63739 WP_003104372.1.63784 WP_003104372.1.63929 WP_003104372.1.63941 WP_003104372.1.63995 WP_003104372.1.64139 WP_003104372.1.64212 WP_003104372.1.64329 WP_003104372.1.64340 WP_003104372.1.64433 WP_003104372.1.64544 WP_003104372.1.64591 WP_003104372.1.64603 WP_003104372.1.64605 WP_003104372.1.6461 WP_003104372.1.64726 WP_003104372.1.64799 WP_003104372.1.64807 WP_003104372.1.64854 WP_003104372.1.64862 WP_003104372.1.64880 WP_003104372.1.64886 WP_003104372.1.64983 WP_003104372.1.64984 WP_003104372.1.65009 WP_003104372.1.65066 WP_003104372.1.65092 WP_003104372.1.65095 WP_003104372.1.65099 WP_003104372.1.65145 WP_003104372.1.65196 WP_003104372.1.65197 WP_003104372.1.65227 WP_003104372.1.65237 WP_003104372.1.65247 WP_003104372.1.65285 WP_003104372.1.65304 WP_003104372.1.65312 WP_003104372.1.65316 WP_003104372.1.65337 WP_003104372.1.65457 WP_003104372.1.65478 WP_003104372.1.65549 WP_003104372.1.65588 WP_003104372.1.65632 WP_003104372.1.65642 WP_003104372.1.65679 WP_003104372.1.65740 WP_003104372.1.65819 WP_003104372.1.65926 WP_003104372.1.66062 WP_003104372.1.66088 WP_003104372.1.66155 WP_003104372.1.66165 WP_003104372.1.6627 WP_003104372.1.66277 WP_003104372.1.6629 WP_003104372.1.66345 WP_003104372.1.66364 WP_003104372.1.66371 WP_003104372.1.66526 WP_003104372.1.66563 WP_003104372.1.66634 WP_003104372.1.66693 WP_003104372.1.66892 WP_003104372.1.66929 WP_003104372.1.66931 WP_003104372.1.66945 WP_003104372.1.66950 WP_003104372.1.66982 WP_003104372.1.67010 WP_003104372.1.67124 WP_003104372.1.67188 WP_003104372.1.67192 WP_003104372.1.67205 WP_003104372.1.67261 WP_003104372.1.67269 WP_003104372.1.6734 WP_003104372.1.67370 WP_003104372.1.67388 WP_003104372.1.67472 WP_003104372.1.67489 WP_003104372.1.67506 WP_003104372.1.67526 WP_003104372.1.67531 WP_003104372.1.67545 WP_003104372.1.6768 WP_003104372.1.67686 WP_003104372.1.67755 WP_003104372.1.67830 WP_003104372.1.67875 WP_003104372.1.67899 WP_003104372.1.67937 WP_003104372.1.6796 WP_003104372.1.68000 WP_003104372.1.6808 WP_003104372.1.68158 WP_003104372.1.68162 WP_003104372.1.68172 WP_003104372.1.68183 WP_003104372.1.68194 WP_003104372.1.68252 WP_003104372.1.68317 WP_003104372.1.68446 WP_003104372.1.68448 WP_003104372.1.68472 WP_003104372.1.68499 WP_003104372.1.6850 WP_003104372.1.68541 WP_003104372.1.68561 WP_003104372.1.68568 WP_003104372.1.68638 WP_003104372.1.68756 WP_003104372.1.68781 WP_003104372.1.68790 WP_003104372.1.68802 WP_003104372.1.68850 WP_003104372.1.68857 WP_003104372.1.68862 WP_003104372.1.68881 WP_003104372.1.68938 WP_003104372.1.68979 WP_003104372.1.69088 WP_003104372.1.6911 WP_003104372.1.69159 WP_003104372.1.69209 WP_003104372.1.69260 WP_003104372.1.6931 WP_003104372.1.69330 WP_003104372.1.69599 WP_003104372.1.69702 WP_003104372.1.69788 WP_003104372.1.69791 WP_003104372.1.69834 WP_003104372.1.69907 WP_003104372.1.69993 WP_003104372.1.70092 WP_003104372.1.70098 WP_003104372.1.70138 WP_003104372.1.70168 WP_003104372.1.70194 WP_003104372.1.70216 WP_003104372.1.70229 WP_003104372.1.70331 WP_003104372.1.70460 WP_003104372.1.70470 WP_003104372.1.70537 WP_003104372.1.70561 WP_003104372.1.70583 WP_003104372.1.70648 WP_003104372.1.70650 WP_003104372.1.70670 WP_003104372.1.70677 WP_003104372.1.70693 WP_003104372.1.7077 WP_003104372.1.70778 WP_003104372.1.70831 WP_003104372.1.70991 WP_003104372.1.71038 WP_003104372.1.71141 WP_003104372.1.71203 WP_003104372.1.71234 WP_003104372.1.71249 WP_003104372.1.71254 WP_003104372.1.7128 WP_003104372.1.71290 WP_003104372.1.71346 WP_003104372.1.71385 WP_003104372.1.71412 WP_003104372.1.71570 WP_003104372.1.71610 WP_003104372.1.7163 WP_003104372.1.71642 WP_003104372.1.71666 WP_003104372.1.71738 WP_003104372.1.71799 WP_003104372.1.71806 WP_003104372.1.71822 WP_003104372.1.71862 WP_003104372.1.71866 WP_003104372.1.71891 WP_003104372.1.72149 WP_003104372.1.72167 WP_003104372.1.72181 WP_003104372.1.72183 WP_003104372.1.7219 WP_003104372.1.72287 WP_003104372.1.72323 WP_003104372.1.72331 WP_003104372.1.72346 WP_003104372.1.72378 WP_003104372.1.72447 WP_003104372.1.72458 WP_003104372.1.72477 WP_003104372.1.72541 WP_003104372.1.72562 WP_003104372.1.72653 WP_003104372.1.72662 WP_003104372.1.72669 WP_003104372.1.72727 WP_003104372.1.7276 WP_003104372.1.72768 WP_003104372.1.72772 WP_003104372.1.72782 WP_003104372.1.72920 WP_003104372.1.73035 WP_003104372.1.73048 WP_003104372.1.7308 WP_003104372.1.73149 WP_003104372.1.7327 WP_003104372.1.7329 WP_003104372.1.733 WP_003104372.1.73455 WP_003104372.1.73490 WP_003104372.1.73523 WP_003104372.1.73541 WP_003104372.1.73601 WP_003104372.1.73651 WP_003104372.1.7377 WP_003104372.1.73791 WP_003104372.1.7382 WP_003104372.1.73860 WP_003104372.1.73889 WP_003104372.1.73911 WP_003104372.1.73941 WP_003104372.1.74 WP_003104372.1.74000 WP_003104372.1.74072 WP_003104372.1.7408 WP_003104372.1.74106 WP_003104372.1.74167 WP_003104372.1.74175 WP_003104372.1.74180 WP_003104372.1.74182 WP_003104372.1.74219 WP_003104372.1.74268 WP_003104372.1.74281 WP_003104372.1.74287 WP_003104372.1.74326 WP_003104372.1.7445 WP_003104372.1.74458 WP_003104372.1.74473 WP_003104372.1.74475 WP_003104372.1.7448 WP_003104372.1.74518 WP_003104372.1.7456 WP_003104372.1.74568 WP_003104372.1.74604 WP_003104372.1.74629 WP_003104372.1.74637 WP_003104372.1.74685 WP_003104372.1.74772 WP_003104372.1.74776 WP_003104372.1.748 WP_003104372.1.74878 WP_003104372.1.74941 WP_003104372.1.74948 WP_003104372.1.74958 WP_003104372.1.7501 WP_003104372.1.75041 WP_003104372.1.75119 WP_003104372.1.75204 WP_003104372.1.75277 WP_003104372.1.75303 WP_003104372.1.75389 WP_003104372.1.75431 WP_003104372.1.7547 WP_003104372.1.75549 WP_003104372.1.75573 WP_003104372.1.75580 WP_003104372.1.75599 WP_003104372.1.75603 WP_003104372.1.75631 WP_003104372.1.7568 WP_003104372.1.75756 WP_003104372.1.75792 WP_003104372.1.75825 WP_003104372.1.75860 WP_003104372.1.75935 WP_003104372.1.75938 WP_003104372.1.7595 WP_003104372.1.76077 WP_003104372.1.76092 WP_003104372.1.76141 WP_003104372.1.76145 WP_003104372.1.76192 WP_003104372.1.76322 WP_003104372.1.76355 WP_003104372.1.76399 WP_003104372.1.76441 WP_003104372.1.76467 WP_003104372.1.76484 WP_003104372.1.76543 WP_003104372.1.76600 WP_003104372.1.76633 WP_003104372.1.7666 WP_003104372.1.76716 WP_003104372.1.76775 WP_003104372.1.76791 WP_003104372.1.76861 WP_003104372.1.76922 WP_003104372.1.76985 WP_003104372.1.77235 WP_003104372.1.77238 WP_003104372.1.77286 WP_003104372.1.77317 WP_003104372.1.77442 WP_003104372.1.77476 WP_003104372.1.77490 WP_003104372.1.77566 WP_003104372.1.77574 WP_003104372.1.77750 WP_003104372.1.77769 WP_003104372.1.7779 WP_003104372.1.77819 WP_003104372.1.77834 WP_003104372.1.77913 WP_003104372.1.78104 WP_003104372.1.78112 WP_003104372.1.78118 WP_003104372.1.78134 WP_003104372.1.78158 WP_003104372.1.78280 WP_003104372.1.78288 WP_003104372.1.78380 WP_003104372.1.7840 WP_003104372.1.78409 WP_003104372.1.78425 WP_003104372.1.78430 WP_003104372.1.78570 WP_003104372.1.78599 WP_003104372.1.78623 WP_003104372.1.78669 WP_003104372.1.78693 WP_003104372.1.78795 WP_003104372.1.788 WP_003104372.1.78926 WP_003104372.1.78947 WP_003104372.1.78954 WP_003104372.1.7899 WP_003104372.1.79003 WP_003104372.1.79053 WP_003104372.1.79060 WP_003104372.1.79177 WP_003104372.1.79193 WP_003104372.1.79256 WP_003104372.1.79279 WP_003104372.1.79286 WP_003104372.1.79311 WP_003104372.1.79357 WP_003104372.1.79364 WP_003104372.1.79429 WP_003104372.1.79431 WP_003104372.1.7945 WP_003104372.1.79463 WP_003104372.1.79507 WP_003104372.1.7953 WP_003104372.1.79544 WP_003104372.1.79569 WP_003104372.1.79699 WP_003104372.1.79754 WP_003104372.1.79788 WP_003104372.1.79862 WP_003104372.1.79883 WP_003104372.1.799 WP_003104372.1.79908 WP_003104372.1.79986 WP_003104372.1.8 WP_003104372.1.80033 WP_003104372.1.80068 WP_003104372.1.80087 WP_003104372.1.80102 WP_003104372.1.8013 WP_003104372.1.80258 WP_003104372.1.80306 WP_003104372.1.8038 WP_003104372.1.80410 WP_003104372.1.80481 WP_003104372.1.8051 WP_003104372.1.80535 WP_003104372.1.80572 WP_003104372.1.80627 WP_003104372.1.80632 WP_003104372.1.8064 WP_003104372.1.80644 WP_003104372.1.80645 WP_003104372.1.80683 WP_003104372.1.80715 WP_003104372.1.80785 WP_003104372.1.80880 WP_003104372.1.80892 WP_003104372.1.80910 WP_003104372.1.80926 WP_003104372.1.80929 WP_003104372.1.80931 WP_003104372.1.81081 WP_003104372.1.81082 WP_003104372.1.81206 WP_003104372.1.81237 WP_003104372.1.81331 WP_003104372.1.81338 WP_003104372.1.81349 WP_003104372.1.81368 WP_003104372.1.8141 WP_003104372.1.81426 WP_003104372.1.81470 WP_003104372.1.81482 WP_003104372.1.81487 WP_003104372.1.81581 WP_003104372.1.81591 WP_003104372.1.81622 WP_003104372.1.81643 WP_003104372.1.81728 WP_003104372.1.81742 WP_003104372.1.81748 WP_003104372.1.81771 WP_003104372.1.81784 WP_003104372.1.81802 WP_003104372.1.81834 WP_003104372.1.81844 WP_003104372.1.81856 WP_003104372.1.81874 WP_003104372.1.81927 WP_003104372.1.81950 WP_003104372.1.81957 WP_003104372.1.81960 WP_003104372.1.81986 WP_003104372.1.82117 WP_003104372.1.82127 WP_003104372.1.82178 WP_003104372.1.8227 WP_003104372.1.82310 WP_003104372.1.82312 WP_003104372.1.82328 WP_003104372.1.82334 WP_003104372.1.8238 WP_003104372.1.82442 WP_003104372.1.82487 WP_003104372.1.82580 WP_003104372.1.82604 WP_003104372.1.82643 WP_003104372.1.82798 WP_003104372.1.82810 WP_003104372.1.8284 WP_003104372.1.82864 WP_003104372.1.82882 WP_003104372.1.82887 WP_003104372.1.82936 WP_003104372.1.83025 WP_003104372.1.83184 WP_003104372.1.83213 WP_003104372.1.83251 WP_003104372.1.83267 WP_003104372.1.83296 WP_003104372.1.83374 WP_003104372.1.83394 WP_003104372.1.83440 WP_003104372.1.83460 WP_003104372.1.83463 WP_003104372.1.835 WP_003104372.1.83503 WP_003104372.1.8351 WP_003104372.1.83540 WP_003104372.1.8357 WP_003104372.1.83637 WP_003104372.1.83673 WP_003104372.1.83698 WP_003104372.1.83871 WP_003104372.1.83937 WP_003104372.1.83946 WP_003104372.1.84003 WP_003104372.1.84008 WP_003104372.1.84162 WP_003104372.1.84174 WP_003104372.1.84177 WP_003104372.1.84178 WP_003104372.1.84190 WP_003104372.1.84271 WP_003104372.1.84297 WP_003104372.1.84374 WP_003104372.1.84398 WP_003104372.1.84439 WP_003104372.1.8453 WP_003104372.1.84538 WP_003104372.1.84558 WP_003104372.1.84589 WP_003104372.1.84674 WP_003104372.1.84684 WP_003104372.1.84702 WP_003104372.1.84715 WP_003104372.1.84754 WP_003104372.1.84792 WP_003104372.1.84825 WP_003104372.1.8484 WP_003104372.1.84937 WP_003104372.1.8498 WP_003104372.1.85028 WP_003104372.1.85059 WP_003104372.1.85150 WP_003104372.1.85220 WP_003104372.1.85290 WP_003104372.1.85298 WP_003104372.1.85303 WP_003104372.1.85311 WP_003104372.1.85318 WP_003104372.1.85357 WP_003104372.1.85446 WP_003104372.1.85453 WP_003104372.1.85574 WP_003104372.1.85633 WP_003104372.1.85638 WP_003104372.1.85788 WP_003104372.1.85897 WP_003104372.1.85910 WP_003104372.1.85920 WP_003104372.1.85978 WP_003104372.1.86002 WP_003104372.1.86047 WP_003104372.1.86055 WP_003104372.1.86058 WP_003104372.1.86125 WP_003104372.1.86182 WP_003104372.1.86243 WP_003104372.1.86278 WP_003104372.1.86287 WP_003104372.1.86293 WP_003104372.1.86386 WP_003104372.1.86432 WP_003104372.1.8645 WP_003104372.1.865 WP_003104372.1.86506 WP_003104372.1.86545 WP_003104372.1.86552 WP_003104372.1.86554 WP_003104372.1.86595 WP_003104372.1.86652 WP_003104372.1.86665 WP_003104372.1.867 WP_003104372.1.86708 WP_003104372.1.86733 WP_003104372.1.86774 WP_003104372.1.86780 WP_003104372.1.86785 WP_003104372.1.86796 WP_003104372.1.86813 WP_003104372.1.8693 WP_003104372.1.86947 WP_003104372.1.86970 WP_003104372.1.86985 WP_003104372.1.87163 WP_003104372.1.8718 WP_003104372.1.87183 WP_003104372.1.87316 WP_003104372.1.87390 WP_003104372.1.87435 WP_003104372.1.87463 WP_003104372.1.8749 WP_003104372.1.87530 WP_003104372.1.87547 WP_003104372.1.87648 WP_003104372.1.87763 WP_003104372.1.8785 WP_003104372.1.87877 WP_003104372.1.87888 WP_003104372.1.87970 WP_003104372.1.87975 WP_003104372.1.87981 WP_003104372.1.87987 WP_003104372.1.88004 WP_003104372.1.88330 WP_003104372.1.88360 WP_003104372.1.88388 WP_003104372.1.88517 WP_003104372.1.8852 WP_003104372.1.88540 WP_003104372.1.88550 WP_003104372.1.88578 WP_003104372.1.88605 WP_003104372.1.88659 WP_003104372.1.88679 WP_003104372.1.88680 WP_003104372.1.88714 WP_003104372.1.88750 WP_003104372.1.88796 WP_003104372.1.889 WP_003104372.1.88900 WP_003104372.1.88949 WP_003104372.1.88969 WP_003104372.1.89083 WP_003104372.1.89098 WP_003104372.1.8911 WP_003104372.1.89234 WP_003104372.1.89245 WP_003104372.1.89266 WP_003104372.1.89276 WP_003104372.1.89330 WP_003104372.1.89409 WP_003104372.1.89434 WP_003104372.1.89440 WP_003104372.1.89480 WP_003104372.1.8949 WP_003104372.1.89491 WP_003104372.1.89523 WP_003104372.1.89577 WP_003104372.1.89610 WP_003104372.1.89662 WP_003104372.1.89669 WP_003104372.1.89736 WP_003104372.1.8976 WP_003104372.1.89776 WP_003104372.1.89805 WP_003104372.1.89866 WP_003104372.1.89867 WP_003104372.1.89868 WP_003104372.1.89871 WP_003104372.1.89886 WP_003104372.1.89992 WP_003104372.1.90024 WP_003104372.1.90056 WP_003104372.1.90110 WP_003104372.1.90141 WP_003104372.1.90150 WP_003104372.1.90189 WP_003104372.1.90224 WP_003104372.1.90225 WP_003104372.1.90242 WP_003104372.1.90268 WP_003104372.1.90272 WP_003104372.1.90306 WP_003104372.1.90412 WP_003104372.1.9056 WP_003104372.1.90569 WP_003104372.1.90655 WP_003104372.1.90940 WP_003104372.1.90999 WP_003104372.1.91012 WP_003104372.1.91093 WP_003104372.1.91161 WP_003104372.1.9120 WP_003104372.1.91204 WP_003104372.1.91236 WP_003104372.1.91281 WP_003104372.1.91307 WP_003104372.1.91336 WP_003104372.1.91360 WP_003104372.1.91392 WP_003104372.1.91416 WP_003104372.1.9143 WP_003104372.1.91431 WP_003104372.1.91438 WP_003104372.1.91467 WP_003104372.1.91527 WP_003104372.1.91563 WP_003104372.1.91585 WP_003104372.1.91796 WP_003104372.1.91803 WP_003104372.1.9182 WP_003104372.1.91838 WP_003104372.1.91846 WP_003104372.1.91860 WP_003104372.1.91862 WP_003104372.1.91882 WP_003104372.1.9191 WP_003104372.1.91943 WP_003104372.1.91996 WP_003104372.1.92043 WP_003104372.1.92175 WP_003104372.1.92314 WP_003104372.1.92357 WP_003104372.1.92454 WP_003104372.1.92573 WP_003104372.1.92587 WP_003104372.1.92589 WP_003104372.1.92624 WP_003104372.1.92630 WP_003104372.1.92642 WP_003104372.1.9272 WP_003104372.1.92769 WP_003104372.1.92839 WP_003104372.1.92847 WP_003104372.1.92894 WP_003104372.1.92930 WP_003104372.1.93122 WP_003104372.1.93130 WP_003104372.1.93144 WP_003104372.1.93148 WP_003104372.1.93196 WP_003104372.1.93264 WP_003104372.1.9328 WP_003104372.1.93446 WP_003104372.1.9349 WP_003104372.1.93493 WP_003104372.1.93498 WP_003104372.1.93520 WP_003104372.1.93547 WP_003104372.1.93562 WP_003104372.1.93568 WP_003104372.1.93797 WP_003104372.1.93889 WP_003104372.1.93897 WP_003104372.1.94004 WP_003104372.1.94031 WP_003104372.1.94065 WP_003104372.1.94078 WP_003104372.1.94136 WP_003104372.1.94174 WP_003104372.1.94211 WP_003104372.1.94218 WP_003104372.1.94230 WP_003104372.1.94243 WP_003104372.1.94288 WP_003104372.1.94333 WP_003104372.1.94349 WP_003104372.1.94385 WP_003104372.1.9444 WP_003104372.1.94450 WP_003104372.1.94682 WP_003104372.1.94742 WP_003104372.1.94814 WP_003104372.1.94818 WP_003104372.1.94856 WP_003104372.1.94874 WP_003104372.1.94881 WP_003104372.1.94897 WP_003104372.1.94943 WP_003104372.1.95018 WP_003104372.1.95027 WP_003104372.1.95056 WP_003104372.1.95117 WP_003104372.1.95132 WP_003104372.1.95187 WP_003104372.1.95207 WP_003104372.1.95217 WP_003104372.1.95324 WP_003104372.1.95354 WP_003104372.1.95359 WP_003104372.1.95460 WP_003104372.1.95488 WP_003104372.1.95525 WP_003104372.1.95536 WP_003104372.1.95638 WP_003104372.1.95668 WP_003104372.1.95745 WP_003104372.1.95751 WP_003104372.1.95774 WP_003104372.1.95782 WP_003104372.1.95802 WP_003104372.1.95820 WP_003104372.1.95825 WP_003104372.1.95959 WP_003104372.1.96008 WP_003104372.1.96058 WP_003104372.1.961 WP_003104372.1.96193 WP_003104372.1.96243 WP_003104372.1.96267 WP_003104372.1.96384 WP_003104372.1.96434 WP_003104372.1.96452 WP_003104372.1.96506 WP_003104372.1.96667 WP_003104372.1.96702 WP_003104372.1.96714 WP_003104372.1.96863 WP_003104372.1.96880 WP_003104372.1.96967 WP_003104372.1.9706 WP_003104372.1.97118 WP_003104372.1.97126 WP_003104372.1.97204 WP_003104372.1.97213 WP_003104372.1.9722 WP_003104372.1.97271 WP_003104372.1.97272 WP_003104372.1.97377 WP_003104372.1.97474 WP_003104372.1.97488 WP_003104372.1.97503 WP_003104372.1.97521 WP_003104372.1.97583 WP_003104372.1.97614 WP_003104372.1.977 WP_003104372.1.97784 WP_003104372.1.97877 WP_003104372.1.97968 WP_003104372.1.98111 WP_003104372.1.98260 WP_003104372.1.98308 WP_003104372.1.98410 WP_003104372.1.98414 WP_003104372.1.98433 WP_003104372.1.9845 WP_003104372.1.985 WP_003104372.1.98515 WP_003104372.1.98522 WP_003104372.1.98573 WP_003104372.1.98600 WP_003104372.1.98610 WP_003104372.1.98672 WP_003104372.1.98678 WP_003104372.1.98693 WP_003104372.1.98788 WP_003104372.1.9885 WP_003104372.1.98873 WP_003104372.1.98907 WP_003104372.1.98926 WP_003104372.1.98960 WP_003104372.1.98963 WP_003104372.1.99065 WP_003104372.1.99068 WP_003104372.1.99103 WP_003104372.1.99214 WP_003104372.1.99293 WP_003104372.1.99378 WP_003104372.1.99386 WP_003104372.1.99389 WP_003104372.1.99443 WP_003104372.1.99461 WP_003104372.1.99516 WP_003104372.1.99647 WP_003104372.1.99654 WP_003104372.1.99662 WP_003104372.1.99746 WP_003104372.1.99757 WP_003104372.1.99772 WP_003104372.1.99795 WP_003104372.1.99835 WP_003104372.1.99930 gi|558667320|ref|YP_008804030.1| 208963.PA14_18230 208964.PA3563 557722.PLES_14701 gi|564951301|ref|YP_008883871.1| gi|116051560|ref|YP_789602.1| gi|218890210|ref|YP_002439074.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]