SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|568153078|ref|YP_008942039.1| from Pseudomonas aeruginosa LES431

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|568153078|ref|YP_008942039.1|
Domain Number 1 Region: 13-124
Classification Level Classification E-value
Superfamily YjgF-like 6.6e-34
Family YjgF/L-PSP 0.0000975
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|568153078|ref|YP_008942039.1|
Sequence length 125
Comment endoribonuclease L-PSP [Pseudomonas aeruginosa LES431]
Sequence
MSDDIQRYPSSLPFPFSRAVRAGGFLFLSGQVPMSPTGEVVRGDIQTQTEAVMARIGETL
ESCGARFDQLVKVTVWLSDMAHFAGFNEVYQRHVQGALPVRSTVTAGLALGVDVEVEVQA
WVGEG
Download sequence
Identical sequences A0A069QDY3 A0A0E1AQP2 A0A0H2ZDA9 A0A0H3R3M1 A0A157WP64 A0A1E9CJZ9 A0A1F0IJB0 A0A1G5DEL9 V6AC68
gi|218890676|ref|YP_002439540.1| gi|568153078|ref|YP_008942039.1| gi|116051119|ref|YP_790050.1| gi|564951743|ref|YP_008884313.1| gi|386067158|ref|YP_005982462.1| 208963.PA14_23720 557722.PLES_19361 gi|478478032|ref|YP_007708683.1| WP_003091402.1.100071 WP_003091402.1.100100 WP_003091402.1.100278 WP_003091402.1.100319 WP_003091402.1.100420 WP_003091402.1.100469 WP_003091402.1.100476 WP_003091402.1.100523 WP_003091402.1.100654 WP_003091402.1.100742 WP_003091402.1.100786 WP_003091402.1.100808 WP_003091402.1.100810 WP_003091402.1.100872 WP_003091402.1.100983 WP_003091402.1.100995 WP_003091402.1.101047 WP_003091402.1.101090 WP_003091402.1.101310 WP_003091402.1.101572 WP_003091402.1.101590 WP_003091402.1.10174 WP_003091402.1.101781 WP_003091402.1.101809 WP_003091402.1.101863 WP_003091402.1.101871 WP_003091402.1.10201 WP_003091402.1.10202 WP_003091402.1.10204 WP_003091402.1.102045 WP_003091402.1.10228 WP_003091402.1.10248 WP_003091402.1.10271 WP_003091402.1.1037 WP_003091402.1.10457 WP_003091402.1.10468 WP_003091402.1.10477 WP_003091402.1.10482 WP_003091402.1.10513 WP_003091402.1.10529 WP_003091402.1.10572 WP_003091402.1.10575 WP_003091402.1.10636 WP_003091402.1.10641 WP_003091402.1.10684 WP_003091402.1.10764 WP_003091402.1.10895 WP_003091402.1.10901 WP_003091402.1.11026 WP_003091402.1.1107 WP_003091402.1.11077 WP_003091402.1.1109 WP_003091402.1.11130 WP_003091402.1.11178 WP_003091402.1.11180 WP_003091402.1.11318 WP_003091402.1.11381 WP_003091402.1.11454 WP_003091402.1.11568 WP_003091402.1.11569 WP_003091402.1.11653 WP_003091402.1.11744 WP_003091402.1.1180 WP_003091402.1.1183 WP_003091402.1.11847 WP_003091402.1.11943 WP_003091402.1.12018 WP_003091402.1.12120 WP_003091402.1.12150 WP_003091402.1.12200 WP_003091402.1.12208 WP_003091402.1.12354 WP_003091402.1.1238 WP_003091402.1.12400 WP_003091402.1.12482 WP_003091402.1.12547 WP_003091402.1.12660 WP_003091402.1.12670 WP_003091402.1.12687 WP_003091402.1.12838 WP_003091402.1.12873 WP_003091402.1.12890 WP_003091402.1.12930 WP_003091402.1.12970 WP_003091402.1.13 WP_003091402.1.13041 WP_003091402.1.1305 WP_003091402.1.13057 WP_003091402.1.13077 WP_003091402.1.13085 WP_003091402.1.13232 WP_003091402.1.13266 WP_003091402.1.13364 WP_003091402.1.13407 WP_003091402.1.13529 WP_003091402.1.13533 WP_003091402.1.1356 WP_003091402.1.1362 WP_003091402.1.13622 WP_003091402.1.13642 WP_003091402.1.13718 WP_003091402.1.13743 WP_003091402.1.13765 WP_003091402.1.13785 WP_003091402.1.13828 WP_003091402.1.14078 WP_003091402.1.14116 WP_003091402.1.14204 WP_003091402.1.14251 WP_003091402.1.14424 WP_003091402.1.14455 WP_003091402.1.14460 WP_003091402.1.14615 WP_003091402.1.14679 WP_003091402.1.14690 WP_003091402.1.14714 WP_003091402.1.1475 WP_003091402.1.14754 WP_003091402.1.14820 WP_003091402.1.14835 WP_003091402.1.14839 WP_003091402.1.14966 WP_003091402.1.14981 WP_003091402.1.15004 WP_003091402.1.1516 WP_003091402.1.152 WP_003091402.1.15222 WP_003091402.1.15373 WP_003091402.1.15408 WP_003091402.1.15474 WP_003091402.1.15480 WP_003091402.1.15482 WP_003091402.1.15485 WP_003091402.1.15602 WP_003091402.1.15666 WP_003091402.1.15889 WP_003091402.1.15934 WP_003091402.1.16109 WP_003091402.1.16142 WP_003091402.1.16161 WP_003091402.1.16197 WP_003091402.1.162 WP_003091402.1.16239 WP_003091402.1.16267 WP_003091402.1.16419 WP_003091402.1.1646 WP_003091402.1.1671 WP_003091402.1.16751 WP_003091402.1.16782 WP_003091402.1.16788 WP_003091402.1.16801 WP_003091402.1.16808 WP_003091402.1.16811 WP_003091402.1.16895 WP_003091402.1.17022 WP_003091402.1.1704 WP_003091402.1.17108 WP_003091402.1.17162 WP_003091402.1.17177 WP_003091402.1.17189 WP_003091402.1.17223 WP_003091402.1.17353 WP_003091402.1.17354 WP_003091402.1.17370 WP_003091402.1.1739 WP_003091402.1.17499 WP_003091402.1.17566 WP_003091402.1.1758 WP_003091402.1.17697 WP_003091402.1.17883 WP_003091402.1.17890 WP_003091402.1.18054 WP_003091402.1.18117 WP_003091402.1.18156 WP_003091402.1.18157 WP_003091402.1.18199 WP_003091402.1.18204 WP_003091402.1.18234 WP_003091402.1.1824 WP_003091402.1.18440 WP_003091402.1.18493 WP_003091402.1.18508 WP_003091402.1.18547 WP_003091402.1.18728 WP_003091402.1.18732 WP_003091402.1.18769 WP_003091402.1.18907 WP_003091402.1.18930 WP_003091402.1.190 WP_003091402.1.19089 WP_003091402.1.19199 WP_003091402.1.19351 WP_003091402.1.19376 WP_003091402.1.19552 WP_003091402.1.19640 WP_003091402.1.19703 WP_003091402.1.1971 WP_003091402.1.19711 WP_003091402.1.19771 WP_003091402.1.19824 WP_003091402.1.20070 WP_003091402.1.2012 WP_003091402.1.20125 WP_003091402.1.20134 WP_003091402.1.20590 WP_003091402.1.20744 WP_003091402.1.20764 WP_003091402.1.20825 WP_003091402.1.20854 WP_003091402.1.20880 WP_003091402.1.20884 WP_003091402.1.20890 WP_003091402.1.209 WP_003091402.1.21002 WP_003091402.1.21242 WP_003091402.1.21253 WP_003091402.1.21349 WP_003091402.1.21358 WP_003091402.1.21448 WP_003091402.1.21471 WP_003091402.1.21517 WP_003091402.1.21718 WP_003091402.1.2172 WP_003091402.1.21744 WP_003091402.1.21782 WP_003091402.1.21801 WP_003091402.1.21932 WP_003091402.1.22078 WP_003091402.1.2228 WP_003091402.1.22324 WP_003091402.1.2237 WP_003091402.1.22389 WP_003091402.1.22704 WP_003091402.1.22729 WP_003091402.1.22863 WP_003091402.1.2289 WP_003091402.1.22891 WP_003091402.1.23191 WP_003091402.1.23195 WP_003091402.1.23418 WP_003091402.1.23512 WP_003091402.1.23518 WP_003091402.1.23525 WP_003091402.1.2355 WP_003091402.1.23581 WP_003091402.1.23611 WP_003091402.1.23641 WP_003091402.1.23715 WP_003091402.1.23782 WP_003091402.1.23884 WP_003091402.1.23938 WP_003091402.1.23961 WP_003091402.1.23967 WP_003091402.1.23983 WP_003091402.1.24066 WP_003091402.1.24183 WP_003091402.1.24234 WP_003091402.1.24319 WP_003091402.1.24351 WP_003091402.1.24413 WP_003091402.1.24662 WP_003091402.1.2477 WP_003091402.1.24851 WP_003091402.1.24862 WP_003091402.1.24869 WP_003091402.1.24940 WP_003091402.1.251 WP_003091402.1.25109 WP_003091402.1.25142 WP_003091402.1.25149 WP_003091402.1.25191 WP_003091402.1.25271 WP_003091402.1.2529 WP_003091402.1.2530 WP_003091402.1.25348 WP_003091402.1.25477 WP_003091402.1.25532 WP_003091402.1.25641 WP_003091402.1.25695 WP_003091402.1.2596 WP_003091402.1.25964 WP_003091402.1.26010 WP_003091402.1.26042 WP_003091402.1.261 WP_003091402.1.26159 WP_003091402.1.26301 WP_003091402.1.26334 WP_003091402.1.26473 WP_003091402.1.26489 WP_003091402.1.2652 WP_003091402.1.26539 WP_003091402.1.26553 WP_003091402.1.26592 WP_003091402.1.26604 WP_003091402.1.26682 WP_003091402.1.26740 WP_003091402.1.26841 WP_003091402.1.2698 WP_003091402.1.27018 WP_003091402.1.27218 WP_003091402.1.27288 WP_003091402.1.27505 WP_003091402.1.27534 WP_003091402.1.27549 WP_003091402.1.27587 WP_003091402.1.27738 WP_003091402.1.27783 WP_003091402.1.27837 WP_003091402.1.27858 WP_003091402.1.27933 WP_003091402.1.27966 WP_003091402.1.28006 WP_003091402.1.28064 WP_003091402.1.28175 WP_003091402.1.28316 WP_003091402.1.28329 WP_003091402.1.28383 WP_003091402.1.28404 WP_003091402.1.28468 WP_003091402.1.28560 WP_003091402.1.28623 WP_003091402.1.28757 WP_003091402.1.28800 WP_003091402.1.28823 WP_003091402.1.28849 WP_003091402.1.28878 WP_003091402.1.28920 WP_003091402.1.29003 WP_003091402.1.29008 WP_003091402.1.29062 WP_003091402.1.29070 WP_003091402.1.29096 WP_003091402.1.29179 WP_003091402.1.29208 WP_003091402.1.29440 WP_003091402.1.29472 WP_003091402.1.29501 WP_003091402.1.29633 WP_003091402.1.29650 WP_003091402.1.29767 WP_003091402.1.2980 WP_003091402.1.29848 WP_003091402.1.29958 WP_003091402.1.29973 WP_003091402.1.30020 WP_003091402.1.30120 WP_003091402.1.30254 WP_003091402.1.3030 WP_003091402.1.30365 WP_003091402.1.30475 WP_003091402.1.30563 WP_003091402.1.30567 WP_003091402.1.30614 WP_003091402.1.30615 WP_003091402.1.30707 WP_003091402.1.3072 WP_003091402.1.30842 WP_003091402.1.30886 WP_003091402.1.31076 WP_003091402.1.31087 WP_003091402.1.31105 WP_003091402.1.31138 WP_003091402.1.31147 WP_003091402.1.31279 WP_003091402.1.31361 WP_003091402.1.31457 WP_003091402.1.31501 WP_003091402.1.31563 WP_003091402.1.31633 WP_003091402.1.31655 WP_003091402.1.3172 WP_003091402.1.31732 WP_003091402.1.31741 WP_003091402.1.31751 WP_003091402.1.31852 WP_003091402.1.32134 WP_003091402.1.32235 WP_003091402.1.32314 WP_003091402.1.32359 WP_003091402.1.32544 WP_003091402.1.32596 WP_003091402.1.32626 WP_003091402.1.32637 WP_003091402.1.32711 WP_003091402.1.32879 WP_003091402.1.32998 WP_003091402.1.33047 WP_003091402.1.33133 WP_003091402.1.33152 WP_003091402.1.33186 WP_003091402.1.33204 WP_003091402.1.33210 WP_003091402.1.33216 WP_003091402.1.33294 WP_003091402.1.33387 WP_003091402.1.33438 WP_003091402.1.33455 WP_003091402.1.33517 WP_003091402.1.33547 WP_003091402.1.33549 WP_003091402.1.33658 WP_003091402.1.33669 WP_003091402.1.3368 WP_003091402.1.33728 WP_003091402.1.33733 WP_003091402.1.33734 WP_003091402.1.3376 WP_003091402.1.33814 WP_003091402.1.33822 WP_003091402.1.33824 WP_003091402.1.33833 WP_003091402.1.3385 WP_003091402.1.33945 WP_003091402.1.34000 WP_003091402.1.34039 WP_003091402.1.34150 WP_003091402.1.34151 WP_003091402.1.34203 WP_003091402.1.34317 WP_003091402.1.3436 WP_003091402.1.34402 WP_003091402.1.34461 WP_003091402.1.3452 WP_003091402.1.34556 WP_003091402.1.34568 WP_003091402.1.34583 WP_003091402.1.34670 WP_003091402.1.34832 WP_003091402.1.34837 WP_003091402.1.35036 WP_003091402.1.35104 WP_003091402.1.35281 WP_003091402.1.3531 WP_003091402.1.35442 WP_003091402.1.35529 WP_003091402.1.3555 WP_003091402.1.35573 WP_003091402.1.35641 WP_003091402.1.35669 WP_003091402.1.35679 WP_003091402.1.35682 WP_003091402.1.3576 WP_003091402.1.35768 WP_003091402.1.35822 WP_003091402.1.35843 WP_003091402.1.35857 WP_003091402.1.35872 WP_003091402.1.35968 WP_003091402.1.36064 WP_003091402.1.36148 WP_003091402.1.36170 WP_003091402.1.36267 WP_003091402.1.36285 WP_003091402.1.36378 WP_003091402.1.36587 WP_003091402.1.36630 WP_003091402.1.36756 WP_003091402.1.36879 WP_003091402.1.37125 WP_003091402.1.37163 WP_003091402.1.37208 WP_003091402.1.3721 WP_003091402.1.37216 WP_003091402.1.373 WP_003091402.1.37319 WP_003091402.1.37366 WP_003091402.1.37416 WP_003091402.1.3742 WP_003091402.1.37512 WP_003091402.1.37571 WP_003091402.1.37698 WP_003091402.1.37799 WP_003091402.1.37814 WP_003091402.1.37818 WP_003091402.1.37826 WP_003091402.1.37842 WP_003091402.1.3785 WP_003091402.1.3792 WP_003091402.1.38023 WP_003091402.1.38087 WP_003091402.1.38146 WP_003091402.1.38151 WP_003091402.1.3818 WP_003091402.1.38186 WP_003091402.1.38319 WP_003091402.1.3833 WP_003091402.1.38335 WP_003091402.1.38337 WP_003091402.1.38450 WP_003091402.1.38502 WP_003091402.1.38510 WP_003091402.1.38583 WP_003091402.1.38657 WP_003091402.1.38661 WP_003091402.1.38706 WP_003091402.1.38816 WP_003091402.1.38889 WP_003091402.1.38932 WP_003091402.1.38971 WP_003091402.1.39088 WP_003091402.1.39186 WP_003091402.1.39271 WP_003091402.1.39345 WP_003091402.1.39444 WP_003091402.1.39704 WP_003091402.1.39765 WP_003091402.1.39786 WP_003091402.1.39920 WP_003091402.1.39949 WP_003091402.1.40115 WP_003091402.1.40207 WP_003091402.1.40213 WP_003091402.1.40237 WP_003091402.1.40243 WP_003091402.1.40271 WP_003091402.1.4038 WP_003091402.1.40442 WP_003091402.1.40512 WP_003091402.1.40546 WP_003091402.1.4058 WP_003091402.1.40950 WP_003091402.1.40984 WP_003091402.1.40993 WP_003091402.1.40994 WP_003091402.1.41110 WP_003091402.1.41137 WP_003091402.1.41199 WP_003091402.1.41290 WP_003091402.1.41301 WP_003091402.1.41384 WP_003091402.1.41412 WP_003091402.1.41429 WP_003091402.1.4156 WP_003091402.1.41732 WP_003091402.1.41748 WP_003091402.1.41832 WP_003091402.1.41871 WP_003091402.1.41888 WP_003091402.1.4190 WP_003091402.1.42 WP_003091402.1.42041 WP_003091402.1.42146 WP_003091402.1.42259 WP_003091402.1.42316 WP_003091402.1.42381 WP_003091402.1.42388 WP_003091402.1.42423 WP_003091402.1.42499 WP_003091402.1.42643 WP_003091402.1.42690 WP_003091402.1.42723 WP_003091402.1.4273 WP_003091402.1.42754 WP_003091402.1.42757 WP_003091402.1.42789 WP_003091402.1.42856 WP_003091402.1.42870 WP_003091402.1.42917 WP_003091402.1.42946 WP_003091402.1.42973 WP_003091402.1.43026 WP_003091402.1.43106 WP_003091402.1.43107 WP_003091402.1.43212 WP_003091402.1.43245 WP_003091402.1.43286 WP_003091402.1.43293 WP_003091402.1.43326 WP_003091402.1.4348 WP_003091402.1.43593 WP_003091402.1.43603 WP_003091402.1.43662 WP_003091402.1.43696 WP_003091402.1.43756 WP_003091402.1.43783 WP_003091402.1.43802 WP_003091402.1.4381 WP_003091402.1.43826 WP_003091402.1.4397 WP_003091402.1.4398 WP_003091402.1.43998 WP_003091402.1.44046 WP_003091402.1.44094 WP_003091402.1.44213 WP_003091402.1.44260 WP_003091402.1.44269 WP_003091402.1.44373 WP_003091402.1.44486 WP_003091402.1.44552 WP_003091402.1.44581 WP_003091402.1.44725 WP_003091402.1.44760 WP_003091402.1.44804 WP_003091402.1.44870 WP_003091402.1.45063 WP_003091402.1.45090 WP_003091402.1.45146 WP_003091402.1.45202 WP_003091402.1.45228 WP_003091402.1.45298 WP_003091402.1.45312 WP_003091402.1.45328 WP_003091402.1.45353 WP_003091402.1.45464 WP_003091402.1.45478 WP_003091402.1.45485 WP_003091402.1.45604 WP_003091402.1.45611 WP_003091402.1.45636 WP_003091402.1.45700 WP_003091402.1.45711 WP_003091402.1.45934 WP_003091402.1.45946 WP_003091402.1.46010 WP_003091402.1.46032 WP_003091402.1.46093 WP_003091402.1.461 WP_003091402.1.46152 WP_003091402.1.46306 WP_003091402.1.4640 WP_003091402.1.46502 WP_003091402.1.46633 WP_003091402.1.46755 WP_003091402.1.46826 WP_003091402.1.46866 WP_003091402.1.46885 WP_003091402.1.46926 WP_003091402.1.46935 WP_003091402.1.4699 WP_003091402.1.47101 WP_003091402.1.47155 WP_003091402.1.4726 WP_003091402.1.47314 WP_003091402.1.47374 WP_003091402.1.47480 WP_003091402.1.47551 WP_003091402.1.47645 WP_003091402.1.47774 WP_003091402.1.47970 WP_003091402.1.48001 WP_003091402.1.48024 WP_003091402.1.48086 WP_003091402.1.48094 WP_003091402.1.48141 WP_003091402.1.48172 WP_003091402.1.48178 WP_003091402.1.48321 WP_003091402.1.48334 WP_003091402.1.4836 WP_003091402.1.48378 WP_003091402.1.48472 WP_003091402.1.48487 WP_003091402.1.48546 WP_003091402.1.48576 WP_003091402.1.48579 WP_003091402.1.48810 WP_003091402.1.48820 WP_003091402.1.48840 WP_003091402.1.48842 WP_003091402.1.48851 WP_003091402.1.49108 WP_003091402.1.49265 WP_003091402.1.49286 WP_003091402.1.49360 WP_003091402.1.49416 WP_003091402.1.49566 WP_003091402.1.49688 WP_003091402.1.49798 WP_003091402.1.49806 WP_003091402.1.49833 WP_003091402.1.49948 WP_003091402.1.49976 WP_003091402.1.49998 WP_003091402.1.50176 WP_003091402.1.50180 WP_003091402.1.50222 WP_003091402.1.5043 WP_003091402.1.50450 WP_003091402.1.50567 WP_003091402.1.50665 WP_003091402.1.50668 WP_003091402.1.50734 WP_003091402.1.50814 WP_003091402.1.50922 WP_003091402.1.51019 WP_003091402.1.51035 WP_003091402.1.51173 WP_003091402.1.51185 WP_003091402.1.51273 WP_003091402.1.51538 WP_003091402.1.51682 WP_003091402.1.51807 WP_003091402.1.51847 WP_003091402.1.51889 WP_003091402.1.51937 WP_003091402.1.51943 WP_003091402.1.51957 WP_003091402.1.51976 WP_003091402.1.52043 WP_003091402.1.52212 WP_003091402.1.52220 WP_003091402.1.5226 WP_003091402.1.52334 WP_003091402.1.52355 WP_003091402.1.52372 WP_003091402.1.52403 WP_003091402.1.52409 WP_003091402.1.52500 WP_003091402.1.52537 WP_003091402.1.5258 WP_003091402.1.52583 WP_003091402.1.52591 WP_003091402.1.5260 WP_003091402.1.52690 WP_003091402.1.52700 WP_003091402.1.52784 WP_003091402.1.52790 WP_003091402.1.52850 WP_003091402.1.5289 WP_003091402.1.52939 WP_003091402.1.5294 WP_003091402.1.53037 WP_003091402.1.53038 WP_003091402.1.53287 WP_003091402.1.53351 WP_003091402.1.53371 WP_003091402.1.53414 WP_003091402.1.53586 WP_003091402.1.53726 WP_003091402.1.53932 WP_003091402.1.53946 WP_003091402.1.53948 WP_003091402.1.54076 WP_003091402.1.54090 WP_003091402.1.54133 WP_003091402.1.54248 WP_003091402.1.54571 WP_003091402.1.54742 WP_003091402.1.54809 WP_003091402.1.54974 WP_003091402.1.55 WP_003091402.1.55089 WP_003091402.1.55169 WP_003091402.1.55387 WP_003091402.1.55543 WP_003091402.1.55813 WP_003091402.1.56013 WP_003091402.1.56037 WP_003091402.1.56145 WP_003091402.1.56196 WP_003091402.1.56229 WP_003091402.1.56315 WP_003091402.1.56348 WP_003091402.1.56452 WP_003091402.1.56465 WP_003091402.1.56474 WP_003091402.1.56475 WP_003091402.1.56626 WP_003091402.1.56632 WP_003091402.1.56745 WP_003091402.1.56797 WP_003091402.1.56819 WP_003091402.1.56864 WP_003091402.1.56973 WP_003091402.1.57005 WP_003091402.1.57020 WP_003091402.1.57065 WP_003091402.1.57113 WP_003091402.1.57276 WP_003091402.1.5731 WP_003091402.1.57339 WP_003091402.1.57369 WP_003091402.1.57417 WP_003091402.1.57566 WP_003091402.1.57792 WP_003091402.1.57841 WP_003091402.1.57853 WP_003091402.1.57921 WP_003091402.1.57966 WP_003091402.1.58019 WP_003091402.1.58183 WP_003091402.1.58193 WP_003091402.1.58200 WP_003091402.1.58360 WP_003091402.1.58417 WP_003091402.1.58436 WP_003091402.1.58482 WP_003091402.1.5850 WP_003091402.1.58510 WP_003091402.1.58527 WP_003091402.1.5856 WP_003091402.1.58581 WP_003091402.1.5869 WP_003091402.1.58800 WP_003091402.1.58838 WP_003091402.1.58845 WP_003091402.1.58944 WP_003091402.1.5897 WP_003091402.1.59013 WP_003091402.1.59076 WP_003091402.1.59123 WP_003091402.1.59176 WP_003091402.1.59212 WP_003091402.1.59246 WP_003091402.1.59249 WP_003091402.1.59250 WP_003091402.1.59339 WP_003091402.1.59385 WP_003091402.1.59563 WP_003091402.1.59688 WP_003091402.1.59724 WP_003091402.1.59831 WP_003091402.1.59943 WP_003091402.1.60051 WP_003091402.1.60062 WP_003091402.1.60084 WP_003091402.1.60085 WP_003091402.1.60396 WP_003091402.1.60415 WP_003091402.1.60467 WP_003091402.1.60472 WP_003091402.1.60602 WP_003091402.1.60603 WP_003091402.1.60639 WP_003091402.1.60686 WP_003091402.1.607 WP_003091402.1.60916 WP_003091402.1.61122 WP_003091402.1.61130 WP_003091402.1.61209 WP_003091402.1.61222 WP_003091402.1.61288 WP_003091402.1.61294 WP_003091402.1.6130 WP_003091402.1.61493 WP_003091402.1.61549 WP_003091402.1.61589 WP_003091402.1.61598 WP_003091402.1.616 WP_003091402.1.61696 WP_003091402.1.6173 WP_003091402.1.62010 WP_003091402.1.62211 WP_003091402.1.62263 WP_003091402.1.6242 WP_003091402.1.62483 WP_003091402.1.62516 WP_003091402.1.62534 WP_003091402.1.62604 WP_003091402.1.62688 WP_003091402.1.62701 WP_003091402.1.62703 WP_003091402.1.62704 WP_003091402.1.62708 WP_003091402.1.62716 WP_003091402.1.62768 WP_003091402.1.62772 WP_003091402.1.6283 WP_003091402.1.62873 WP_003091402.1.62917 WP_003091402.1.62961 WP_003091402.1.62977 WP_003091402.1.63038 WP_003091402.1.63041 WP_003091402.1.63193 WP_003091402.1.63196 WP_003091402.1.63401 WP_003091402.1.63597 WP_003091402.1.63634 WP_003091402.1.63739 WP_003091402.1.63929 WP_003091402.1.63941 WP_003091402.1.63995 WP_003091402.1.64155 WP_003091402.1.64329 WP_003091402.1.64340 WP_003091402.1.6450 WP_003091402.1.64544 WP_003091402.1.64605 WP_003091402.1.6461 WP_003091402.1.64611 WP_003091402.1.64726 WP_003091402.1.64748 WP_003091402.1.64807 WP_003091402.1.64854 WP_003091402.1.64862 WP_003091402.1.64886 WP_003091402.1.64984 WP_003091402.1.65009 WP_003091402.1.65092 WP_003091402.1.65099 WP_003091402.1.65145 WP_003091402.1.65237 WP_003091402.1.65304 WP_003091402.1.65312 WP_003091402.1.65316 WP_003091402.1.65335 WP_003091402.1.65337 WP_003091402.1.65457 WP_003091402.1.65478 WP_003091402.1.65632 WP_003091402.1.65642 WP_003091402.1.65679 WP_003091402.1.65779 WP_003091402.1.65819 WP_003091402.1.6589 WP_003091402.1.65926 WP_003091402.1.66088 WP_003091402.1.66155 WP_003091402.1.66165 WP_003091402.1.6627 WP_003091402.1.6629 WP_003091402.1.66348 WP_003091402.1.66371 WP_003091402.1.66410 WP_003091402.1.66526 WP_003091402.1.66563 WP_003091402.1.66634 WP_003091402.1.66693 WP_003091402.1.66721 WP_003091402.1.66892 WP_003091402.1.66929 WP_003091402.1.66950 WP_003091402.1.66982 WP_003091402.1.67124 WP_003091402.1.67188 WP_003091402.1.67192 WP_003091402.1.67205 WP_003091402.1.67261 WP_003091402.1.67269 WP_003091402.1.67370 WP_003091402.1.67388 WP_003091402.1.67472 WP_003091402.1.67489 WP_003091402.1.67506 WP_003091402.1.67526 WP_003091402.1.67545 WP_003091402.1.67686 WP_003091402.1.67755 WP_003091402.1.67830 WP_003091402.1.67874 WP_003091402.1.67899 WP_003091402.1.67948 WP_003091402.1.6796 WP_003091402.1.68000 WP_003091402.1.68162 WP_003091402.1.68172 WP_003091402.1.68183 WP_003091402.1.68194 WP_003091402.1.68252 WP_003091402.1.68317 WP_003091402.1.68446 WP_003091402.1.68448 WP_003091402.1.68499 WP_003091402.1.6850 WP_003091402.1.68541 WP_003091402.1.68638 WP_003091402.1.6866 WP_003091402.1.68756 WP_003091402.1.68781 WP_003091402.1.68790 WP_003091402.1.68850 WP_003091402.1.68857 WP_003091402.1.68862 WP_003091402.1.68881 WP_003091402.1.68910 WP_003091402.1.68938 WP_003091402.1.68979 WP_003091402.1.69088 WP_003091402.1.69159 WP_003091402.1.69209 WP_003091402.1.69260 WP_003091402.1.69330 WP_003091402.1.6937 WP_003091402.1.69411 WP_003091402.1.69702 WP_003091402.1.69788 WP_003091402.1.69907 WP_003091402.1.69993 WP_003091402.1.70092 WP_003091402.1.70194 WP_003091402.1.70216 WP_003091402.1.70229 WP_003091402.1.70460 WP_003091402.1.70470 WP_003091402.1.70537 WP_003091402.1.70561 WP_003091402.1.70648 WP_003091402.1.70650 WP_003091402.1.70670 WP_003091402.1.70693 WP_003091402.1.7077 WP_003091402.1.70778 WP_003091402.1.71038 WP_003091402.1.71234 WP_003091402.1.71249 WP_003091402.1.7128 WP_003091402.1.71290 WP_003091402.1.71412 WP_003091402.1.71570 WP_003091402.1.71610 WP_003091402.1.7163 WP_003091402.1.71666 WP_003091402.1.71738 WP_003091402.1.71799 WP_003091402.1.71806 WP_003091402.1.71866 WP_003091402.1.71891 WP_003091402.1.71927 WP_003091402.1.72149 WP_003091402.1.72167 WP_003091402.1.72181 WP_003091402.1.72183 WP_003091402.1.7219 WP_003091402.1.72287 WP_003091402.1.72323 WP_003091402.1.72331 WP_003091402.1.72477 WP_003091402.1.72541 WP_003091402.1.72570 WP_003091402.1.72653 WP_003091402.1.72662 WP_003091402.1.7276 WP_003091402.1.72768 WP_003091402.1.72782 WP_003091402.1.72920 WP_003091402.1.73035 WP_003091402.1.73048 WP_003091402.1.7308 WP_003091402.1.73149 WP_003091402.1.73192 WP_003091402.1.7327 WP_003091402.1.733 WP_003091402.1.73490 WP_003091402.1.73523 WP_003091402.1.73601 WP_003091402.1.73719 WP_003091402.1.7377 WP_003091402.1.73791 WP_003091402.1.7382 WP_003091402.1.73860 WP_003091402.1.73911 WP_003091402.1.74000 WP_003091402.1.74072 WP_003091402.1.74074 WP_003091402.1.74106 WP_003091402.1.74167 WP_003091402.1.74182 WP_003091402.1.74219 WP_003091402.1.74264 WP_003091402.1.74281 WP_003091402.1.74326 WP_003091402.1.7445 WP_003091402.1.74458 WP_003091402.1.74473 WP_003091402.1.7448 WP_003091402.1.74568 WP_003091402.1.74604 WP_003091402.1.74685 WP_003091402.1.748 WP_003091402.1.74941 WP_003091402.1.74948 WP_003091402.1.74958 WP_003091402.1.7501 WP_003091402.1.75041 WP_003091402.1.75119 WP_003091402.1.75204 WP_003091402.1.75277 WP_003091402.1.75389 WP_003091402.1.75431 WP_003091402.1.7547 WP_003091402.1.75549 WP_003091402.1.75573 WP_003091402.1.75580 WP_003091402.1.75599 WP_003091402.1.75603 WP_003091402.1.7568 WP_003091402.1.75756 WP_003091402.1.75771 WP_003091402.1.75792 WP_003091402.1.75826 WP_003091402.1.75935 WP_003091402.1.75947 WP_003091402.1.7595 WP_003091402.1.76077 WP_003091402.1.76092 WP_003091402.1.76141 WP_003091402.1.76145 WP_003091402.1.76355 WP_003091402.1.76399 WP_003091402.1.76441 WP_003091402.1.76543 WP_003091402.1.76600 WP_003091402.1.76633 WP_003091402.1.76716 WP_003091402.1.76775 WP_003091402.1.76791 WP_003091402.1.76985 WP_003091402.1.77235 WP_003091402.1.77238 WP_003091402.1.77317 WP_003091402.1.77442 WP_003091402.1.77490 WP_003091402.1.77686 WP_003091402.1.77750 WP_003091402.1.77769 WP_003091402.1.77819 WP_003091402.1.77834 WP_003091402.1.78112 WP_003091402.1.78118 WP_003091402.1.78148 WP_003091402.1.78280 WP_003091402.1.78288 WP_003091402.1.78380 WP_003091402.1.78409 WP_003091402.1.78430 WP_003091402.1.78570 WP_003091402.1.78599 WP_003091402.1.78623 WP_003091402.1.78795 WP_003091402.1.78810 WP_003091402.1.78947 WP_003091402.1.78986 WP_003091402.1.79003 WP_003091402.1.79007 WP_003091402.1.79053 WP_003091402.1.79060 WP_003091402.1.79279 WP_003091402.1.79286 WP_003091402.1.79311 WP_003091402.1.79421 WP_003091402.1.79429 WP_003091402.1.7945 WP_003091402.1.79507 WP_003091402.1.7953 WP_003091402.1.79569 WP_003091402.1.79754 WP_003091402.1.79788 WP_003091402.1.79902 WP_003091402.1.80087 WP_003091402.1.8013 WP_003091402.1.80174 WP_003091402.1.80258 WP_003091402.1.80306 WP_003091402.1.8038 WP_003091402.1.80410 WP_003091402.1.80411 WP_003091402.1.80454 WP_003091402.1.80481 WP_003091402.1.8051 WP_003091402.1.80535 WP_003091402.1.80627 WP_003091402.1.8064 WP_003091402.1.80645 WP_003091402.1.80683 WP_003091402.1.80715 WP_003091402.1.80720 WP_003091402.1.80785 WP_003091402.1.80926 WP_003091402.1.80931 WP_003091402.1.80938 WP_003091402.1.81081 WP_003091402.1.8110 WP_003091402.1.81338 WP_003091402.1.81349 WP_003091402.1.81368 WP_003091402.1.81380 WP_003091402.1.8141 WP_003091402.1.81426 WP_003091402.1.81470 WP_003091402.1.81482 WP_003091402.1.81487 WP_003091402.1.81622 WP_003091402.1.81742 WP_003091402.1.81784 WP_003091402.1.81802 WP_003091402.1.81816 WP_003091402.1.81834 WP_003091402.1.81844 WP_003091402.1.81856 WP_003091402.1.81874 WP_003091402.1.81927 WP_003091402.1.81950 WP_003091402.1.82117 WP_003091402.1.82127 WP_003091402.1.82260 WP_003091402.1.82310 WP_003091402.1.82312 WP_003091402.1.82328 WP_003091402.1.82334 WP_003091402.1.82604 WP_003091402.1.82643 WP_003091402.1.82798 WP_003091402.1.82810 WP_003091402.1.82864 WP_003091402.1.82936 WP_003091402.1.83131 WP_003091402.1.83184 WP_003091402.1.83213 WP_003091402.1.83251 WP_003091402.1.83267 WP_003091402.1.83296 WP_003091402.1.83317 WP_003091402.1.83394 WP_003091402.1.83440 WP_003091402.1.83460 WP_003091402.1.835 WP_003091402.1.83503 WP_003091402.1.8351 WP_003091402.1.8353 WP_003091402.1.83534 WP_003091402.1.83540 WP_003091402.1.8357 WP_003091402.1.83637 WP_003091402.1.83871 WP_003091402.1.83937 WP_003091402.1.83946 WP_003091402.1.84003 WP_003091402.1.84008 WP_003091402.1.84138 WP_003091402.1.84174 WP_003091402.1.84177 WP_003091402.1.84190 WP_003091402.1.84271 WP_003091402.1.84297 WP_003091402.1.84374 WP_003091402.1.84398 WP_003091402.1.84487 WP_003091402.1.84526 WP_003091402.1.8453 WP_003091402.1.84558 WP_003091402.1.84589 WP_003091402.1.84674 WP_003091402.1.84702 WP_003091402.1.84825 WP_003091402.1.8484 WP_003091402.1.85059 WP_003091402.1.85150 WP_003091402.1.85220 WP_003091402.1.85290 WP_003091402.1.85303 WP_003091402.1.85318 WP_003091402.1.85633 WP_003091402.1.85638 WP_003091402.1.85788 WP_003091402.1.85897 WP_003091402.1.85910 WP_003091402.1.85920 WP_003091402.1.85978 WP_003091402.1.86058 WP_003091402.1.86125 WP_003091402.1.86243 WP_003091402.1.86278 WP_003091402.1.86287 WP_003091402.1.86293 WP_003091402.1.86432 WP_003091402.1.8645 WP_003091402.1.865 WP_003091402.1.86506 WP_003091402.1.86545 WP_003091402.1.86552 WP_003091402.1.86595 WP_003091402.1.86652 WP_003091402.1.86665 WP_003091402.1.867 WP_003091402.1.86785 WP_003091402.1.86796 WP_003091402.1.86813 WP_003091402.1.86970 WP_003091402.1.87163 WP_003091402.1.8718 WP_003091402.1.8727 WP_003091402.1.87316 WP_003091402.1.87390 WP_003091402.1.87435 WP_003091402.1.87463 WP_003091402.1.8749 WP_003091402.1.87530 WP_003091402.1.87648 WP_003091402.1.87763 WP_003091402.1.8777 WP_003091402.1.8785 WP_003091402.1.87975 WP_003091402.1.87981 WP_003091402.1.88004 WP_003091402.1.88308 WP_003091402.1.88540 WP_003091402.1.88550 WP_003091402.1.88578 WP_003091402.1.88605 WP_003091402.1.88714 WP_003091402.1.88750 WP_003091402.1.8911 WP_003091402.1.89245 WP_003091402.1.89276 WP_003091402.1.89330 WP_003091402.1.89409 WP_003091402.1.89480 WP_003091402.1.89491 WP_003091402.1.89577 WP_003091402.1.89610 WP_003091402.1.89662 WP_003091402.1.89669 WP_003091402.1.89736 WP_003091402.1.8976 WP_003091402.1.89805 WP_003091402.1.89866 WP_003091402.1.89871 WP_003091402.1.89886 WP_003091402.1.90056 WP_003091402.1.90150 WP_003091402.1.90224 WP_003091402.1.90225 WP_003091402.1.90242 WP_003091402.1.90272 WP_003091402.1.90306 WP_003091402.1.90412 WP_003091402.1.9056 WP_003091402.1.90569 WP_003091402.1.90655 WP_003091402.1.90770 WP_003091402.1.91012 WP_003091402.1.91093 WP_003091402.1.91161 WP_003091402.1.9120 WP_003091402.1.91204 WP_003091402.1.91236 WP_003091402.1.91392 WP_003091402.1.91416 WP_003091402.1.9143 WP_003091402.1.91431 WP_003091402.1.91527 WP_003091402.1.91796 WP_003091402.1.91803 WP_003091402.1.91860 WP_003091402.1.91862 WP_003091402.1.91882 WP_003091402.1.9191 WP_003091402.1.91938 WP_003091402.1.91996 WP_003091402.1.9219 WP_003091402.1.92314 WP_003091402.1.92357 WP_003091402.1.92454 WP_003091402.1.92573 WP_003091402.1.92585 WP_003091402.1.92594 WP_003091402.1.92624 WP_003091402.1.92630 WP_003091402.1.92769 WP_003091402.1.92839 WP_003091402.1.92847 WP_003091402.1.92930 WP_003091402.1.93001 WP_003091402.1.93144 WP_003091402.1.93196 WP_003091402.1.9328 WP_003091402.1.9349 WP_003091402.1.93498 WP_003091402.1.93520 WP_003091402.1.93568 WP_003091402.1.93797 WP_003091402.1.93889 WP_003091402.1.94004 WP_003091402.1.94031 WP_003091402.1.94078 WP_003091402.1.94218 WP_003091402.1.94221 WP_003091402.1.94230 WP_003091402.1.94288 WP_003091402.1.94333 WP_003091402.1.94434 WP_003091402.1.94682 WP_003091402.1.94732 WP_003091402.1.94742 WP_003091402.1.94814 WP_003091402.1.94818 WP_003091402.1.94856 WP_003091402.1.94874 WP_003091402.1.94881 WP_003091402.1.94943 WP_003091402.1.95025 WP_003091402.1.95027 WP_003091402.1.95117 WP_003091402.1.95187 WP_003091402.1.95207 WP_003091402.1.95354 WP_003091402.1.95460 WP_003091402.1.95488 WP_003091402.1.95525 WP_003091402.1.95536 WP_003091402.1.95668 WP_003091402.1.95745 WP_003091402.1.95751 WP_003091402.1.95782 WP_003091402.1.95820 WP_003091402.1.95825 WP_003091402.1.9599 WP_003091402.1.95994 WP_003091402.1.95999 WP_003091402.1.9604 WP_003091402.1.96058 WP_003091402.1.961 WP_003091402.1.96243 WP_003091402.1.96267 WP_003091402.1.96506 WP_003091402.1.96863 WP_003091402.1.96967 WP_003091402.1.97118 WP_003091402.1.97213 WP_003091402.1.9722 WP_003091402.1.97271 WP_003091402.1.97377 WP_003091402.1.97461 WP_003091402.1.97474 WP_003091402.1.97488 WP_003091402.1.97499 WP_003091402.1.97503 WP_003091402.1.97583 WP_003091402.1.97614 WP_003091402.1.97784 WP_003091402.1.97826 WP_003091402.1.97968 WP_003091402.1.98111 WP_003091402.1.98260 WP_003091402.1.98276 WP_003091402.1.98410 WP_003091402.1.98414 WP_003091402.1.98433 WP_003091402.1.985 WP_003091402.1.98522 WP_003091402.1.98573 WP_003091402.1.98610 WP_003091402.1.98672 WP_003091402.1.98788 WP_003091402.1.98873 WP_003091402.1.98960 WP_003091402.1.99065 WP_003091402.1.99068 WP_003091402.1.99103 WP_003091402.1.99293 WP_003091402.1.99353 WP_003091402.1.99378 WP_003091402.1.99386 WP_003091402.1.99461 WP_003091402.1.99662 WP_003091402.1.99746 WP_003091402.1.99757 WP_003091402.1.99772 WP_003091402.1.99795 WP_003091402.1.99835 WP_003091402.1.9989 WP_003091402.1.99930

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]