SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|568154191|ref|YP_008943169.1| from Pseudomonas aeruginosa LES431

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|568154191|ref|YP_008943169.1|
Domain Number 1 Region: 69-330
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like I 5.5e-60
Family L-arabinose binding protein-like 0.00024
Further Details:      
 
Domain Number 2 Region: 11-70
Classification Level Classification E-value
Superfamily lambda repressor-like DNA-binding domains 0.0000000000000938
Family GalR/LacI-like bacterial regulator 0.0056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|568154191|ref|YP_008943169.1|
Sequence length 340
Comment transcriptional regulator [Pseudomonas aeruginosa LES431]
Sequence
MNGSVLPSRGRVTINQVAEAAGVSKASVSRYIGGDRQLLADATARRIERAIDQLDYRPNQ
MARGLKRGRTRLIGMLVADILNPYSVAVMHGVETACREHGYSLVVCNTDRDDEQERHHLA
ALQSYNVEGLIVNTLGHHPGELRALHRELPMVLVDRQLAELDTDLVGLDNADAVEQALDH
LQHRGFRDILLVTEPLDGTSSRIERVQAFNASIGRRPALKGQVLQTDDFFRNGLRAFLSA
SGPGPKALFTCNGVATLCATRQLRDLGCRLFDEVGLLALDELDWYPLVGSGITALAQPTD
EIGRTAFERLLARLEGDREPARRVTFPAQLIVRGSTHPRG
Download sequence
Identical sequences gi|568154191|ref|YP_008943169.1| gi|218891767|ref|YP_002440634.1| WP_012614175.1.11026 WP_012614175.1.1107 WP_012614175.1.11943 WP_012614175.1.12838 WP_012614175.1.13232 WP_012614175.1.14714 WP_012614175.1.1475 WP_012614175.1.21517 WP_012614175.1.22863 WP_012614175.1.23195 WP_012614175.1.23715 WP_012614175.1.24351 WP_012614175.1.251 WP_012614175.1.25142 WP_012614175.1.27837 WP_012614175.1.31279 WP_012614175.1.32544 WP_012614175.1.33210 WP_012614175.1.34832 WP_012614175.1.35857 WP_012614175.1.3833 WP_012614175.1.39088 WP_012614175.1.43662 WP_012614175.1.45090 WP_012614175.1.45485 WP_012614175.1.45934 WP_012614175.1.46152 WP_012614175.1.47774 WP_012614175.1.52690 WP_012614175.1.56797 WP_012614175.1.59076 WP_012614175.1.60415 WP_012614175.1.60603 WP_012614175.1.61696 WP_012614175.1.62516 WP_012614175.1.62534 WP_012614175.1.62701 WP_012614175.1.65099 WP_012614175.1.66526 WP_012614175.1.67388 WP_012614175.1.67686 WP_012614175.1.68862 WP_012614175.1.72331 WP_012614175.1.73149 WP_012614175.1.7547 WP_012614175.1.78430 WP_012614175.1.84374 WP_012614175.1.86545 WP_012614175.1.87435 WP_012614175.1.91431 WP_012614175.1.92769 WP_012614175.1.95460 WP_012614175.1.9722 WP_012614175.1.99461 WP_012614175.1.99757 557722.PLES_30451

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]