SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|568154907|ref|YP_008943892.1| from Pseudomonas aeruginosa LES431

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|568154907|ref|YP_008943892.1|
Domain Number 1 Region: 14-116
Classification Level Classification E-value
Superfamily YjgF-like 1.1e-29
Family YjgF/L-PSP 0.00094
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|568154907|ref|YP_008943892.1|
Sequence length 117
Comment endoribonuclease [Pseudomonas aeruginosa LES431]
Sequence
MHIERFEVVKRRAEMALHGNTVYIGGQVADDPSGDIQDQTRQILENIDRLLQSVGSDRGQ
VLSVRILLAHREDYAGLNQVWDQWFPEGRAPTRACSLAELIDPRWRVEMIVVAARPQ
Download sequence
Identical sequences A0A0C7CYJ3 A0A0H3QN68 A0A1E9BTT2 A0A1F0I2V5 A0A1G5G7I5 A0A1S1BZI1 Q9I3E9
gi|386059543|ref|YP_005976065.1| gi|218892476|ref|YP_002441343.1| gi|568310581|ref|YP_008982850.1| gi|15596765|ref|NP_250259.1| gi|568154907|ref|YP_008943892.1| NP_250259.1.87394 WP_003104412.1.100071 WP_003104412.1.100100 WP_003104412.1.100420 WP_003104412.1.100456 WP_003104412.1.100473 WP_003104412.1.100523 WP_003104412.1.100654 WP_003104412.1.100786 WP_003104412.1.100810 WP_003104412.1.100872 WP_003104412.1.100995 WP_003104412.1.101090 WP_003104412.1.101340 WP_003104412.1.101506 WP_003104412.1.101572 WP_003104412.1.101712 WP_003104412.1.10179 WP_003104412.1.10185 WP_003104412.1.101863 WP_003104412.1.101871 WP_003104412.1.10201 WP_003104412.1.10202 WP_003104412.1.10204 WP_003104412.1.102045 WP_003104412.1.10228 WP_003104412.1.10257 WP_003104412.1.10419 WP_003104412.1.10468 WP_003104412.1.10477 WP_003104412.1.10482 WP_003104412.1.10529 WP_003104412.1.10572 WP_003104412.1.10641 WP_003104412.1.10684 WP_003104412.1.10901 WP_003104412.1.11026 WP_003104412.1.1107 WP_003104412.1.11077 WP_003104412.1.1109 WP_003104412.1.11163 WP_003104412.1.11178 WP_003104412.1.11381 WP_003104412.1.11410 WP_003104412.1.11417 WP_003104412.1.11568 WP_003104412.1.11653 WP_003104412.1.11744 WP_003104412.1.11754 WP_003104412.1.1180 WP_003104412.1.11847 WP_003104412.1.11854 WP_003104412.1.11943 WP_003104412.1.12120 WP_003104412.1.12208 WP_003104412.1.12302 WP_003104412.1.1238 WP_003104412.1.12482 WP_003104412.1.12497 WP_003104412.1.12561 WP_003104412.1.12670 WP_003104412.1.12687 WP_003104412.1.12838 WP_003104412.1.12873 WP_003104412.1.12891 WP_003104412.1.12922 WP_003104412.1.12970 WP_003104412.1.13 WP_003104412.1.1305 WP_003104412.1.13057 WP_003104412.1.13092 WP_003104412.1.13208 WP_003104412.1.13232 WP_003104412.1.13315 WP_003104412.1.1333 WP_003104412.1.13407 WP_003104412.1.13529 WP_003104412.1.1356 WP_003104412.1.1362 WP_003104412.1.13622 WP_003104412.1.13765 WP_003104412.1.13785 WP_003104412.1.13795 WP_003104412.1.1393 WP_003104412.1.14078 WP_003104412.1.14204 WP_003104412.1.14378 WP_003104412.1.14424 WP_003104412.1.14460 WP_003104412.1.14564 WP_003104412.1.14640 WP_003104412.1.14714 WP_003104412.1.1475 WP_003104412.1.14754 WP_003104412.1.14820 WP_003104412.1.14835 WP_003104412.1.14966 WP_003104412.1.15004 WP_003104412.1.15130 WP_003104412.1.152 WP_003104412.1.15222 WP_003104412.1.15231 WP_003104412.1.15281 WP_003104412.1.15474 WP_003104412.1.15482 WP_003104412.1.15485 WP_003104412.1.15602 WP_003104412.1.15886 WP_003104412.1.15934 WP_003104412.1.16109 WP_003104412.1.16142 WP_003104412.1.16161 WP_003104412.1.16197 WP_003104412.1.162 WP_003104412.1.16239 WP_003104412.1.16242 WP_003104412.1.16267 WP_003104412.1.16279 WP_003104412.1.16419 WP_003104412.1.1646 WP_003104412.1.16694 WP_003104412.1.1671 WP_003104412.1.16782 WP_003104412.1.16788 WP_003104412.1.16801 WP_003104412.1.16808 WP_003104412.1.16895 WP_003104412.1.17022 WP_003104412.1.17155 WP_003104412.1.17162 WP_003104412.1.17353 WP_003104412.1.17354 WP_003104412.1.17370 WP_003104412.1.1739 WP_003104412.1.17566 WP_003104412.1.17697 WP_003104412.1.17883 WP_003104412.1.17890 WP_003104412.1.18052 WP_003104412.1.18117 WP_003104412.1.18204 WP_003104412.1.18234 WP_003104412.1.18493 WP_003104412.1.18653 WP_003104412.1.18728 WP_003104412.1.18735 WP_003104412.1.18769 WP_003104412.1.18852 WP_003104412.1.18892 WP_003104412.1.190 WP_003104412.1.19251 WP_003104412.1.19269 WP_003104412.1.19552 WP_003104412.1.19591 WP_003104412.1.19703 WP_003104412.1.1971 WP_003104412.1.19711 WP_003104412.1.19741 WP_003104412.1.19771 WP_003104412.1.19931 WP_003104412.1.20070 WP_003104412.1.20134 WP_003104412.1.20682 WP_003104412.1.20744 WP_003104412.1.20764 WP_003104412.1.20854 WP_003104412.1.20884 WP_003104412.1.209 WP_003104412.1.20929 WP_003104412.1.21242 WP_003104412.1.21302 WP_003104412.1.21349 WP_003104412.1.21358 WP_003104412.1.21448 WP_003104412.1.21469 WP_003104412.1.21471 WP_003104412.1.21517 WP_003104412.1.21607 WP_003104412.1.21718 WP_003104412.1.2172 WP_003104412.1.21744 WP_003104412.1.21767 WP_003104412.1.21782 WP_003104412.1.21801 WP_003104412.1.21863 WP_003104412.1.21871 WP_003104412.1.21891 WP_003104412.1.21932 WP_003104412.1.22078 WP_003104412.1.221 WP_003104412.1.2228 WP_003104412.1.22324 WP_003104412.1.22389 WP_003104412.1.22477 WP_003104412.1.22491 WP_003104412.1.22573 WP_003104412.1.22729 WP_003104412.1.22863 WP_003104412.1.2289 WP_003104412.1.22891 WP_003104412.1.23013 WP_003104412.1.23195 WP_003104412.1.2323 WP_003104412.1.23331 WP_003104412.1.23394 WP_003104412.1.23418 WP_003104412.1.23512 WP_003104412.1.23525 WP_003104412.1.23581 WP_003104412.1.23611 WP_003104412.1.23641 WP_003104412.1.23715 WP_003104412.1.23739 WP_003104412.1.23769 WP_003104412.1.23794 WP_003104412.1.23884 WP_003104412.1.23925 WP_003104412.1.23961 WP_003104412.1.23967 WP_003104412.1.23983 WP_003104412.1.24066 WP_003104412.1.24077 WP_003104412.1.24087 WP_003104412.1.24351 WP_003104412.1.24447 WP_003104412.1.2453 WP_003104412.1.24662 WP_003104412.1.24879 WP_003104412.1.24938 WP_003104412.1.25033 WP_003104412.1.25052 WP_003104412.1.25067 WP_003104412.1.251 WP_003104412.1.25109 WP_003104412.1.2511 WP_003104412.1.25142 WP_003104412.1.25149 WP_003104412.1.25191 WP_003104412.1.2529 WP_003104412.1.25348 WP_003104412.1.2535 WP_003104412.1.25477 WP_003104412.1.25532 WP_003104412.1.2572 WP_003104412.1.2596 WP_003104412.1.25964 WP_003104412.1.26025 WP_003104412.1.26042 WP_003104412.1.261 WP_003104412.1.26159 WP_003104412.1.26301 WP_003104412.1.26334 WP_003104412.1.26428 WP_003104412.1.26489 WP_003104412.1.2652 WP_003104412.1.26539 WP_003104412.1.26592 WP_003104412.1.26604 WP_003104412.1.26681 WP_003104412.1.26682 WP_003104412.1.26705 WP_003104412.1.26740 WP_003104412.1.26816 WP_003104412.1.26841 WP_003104412.1.26967 WP_003104412.1.2698 WP_003104412.1.27018 WP_003104412.1.27028 WP_003104412.1.27211 WP_003104412.1.27218 WP_003104412.1.27259 WP_003104412.1.27505 WP_003104412.1.27534 WP_003104412.1.27575 WP_003104412.1.27587 WP_003104412.1.27738 WP_003104412.1.27783 WP_003104412.1.27837 WP_003104412.1.27858 WP_003104412.1.27939 WP_003104412.1.28006 WP_003104412.1.28057 WP_003104412.1.28064 WP_003104412.1.28136 WP_003104412.1.28175 WP_003104412.1.28372 WP_003104412.1.28382 WP_003104412.1.28468 WP_003104412.1.28623 WP_003104412.1.28800 WP_003104412.1.28823 WP_003104412.1.28849 WP_003104412.1.28920 WP_003104412.1.29137 WP_003104412.1.29179 WP_003104412.1.29208 WP_003104412.1.2927 WP_003104412.1.29401 WP_003104412.1.2941 WP_003104412.1.29438 WP_003104412.1.29472 WP_003104412.1.2948 WP_003104412.1.29481 WP_003104412.1.29498 WP_003104412.1.29501 WP_003104412.1.29577 WP_003104412.1.29767 WP_003104412.1.2980 WP_003104412.1.29848 WP_003104412.1.30000 WP_003104412.1.30081 WP_003104412.1.30120 WP_003104412.1.30475 WP_003104412.1.30567 WP_003104412.1.30614 WP_003104412.1.30625 WP_003104412.1.30707 WP_003104412.1.3072 WP_003104412.1.30886 WP_003104412.1.30973 WP_003104412.1.30994 WP_003104412.1.31045 WP_003104412.1.31076 WP_003104412.1.31087 WP_003104412.1.31103 WP_003104412.1.31105 WP_003104412.1.31138 WP_003104412.1.31147 WP_003104412.1.31279 WP_003104412.1.31361 WP_003104412.1.31501 WP_003104412.1.31565 WP_003104412.1.31741 WP_003104412.1.31848 WP_003104412.1.31852 WP_003104412.1.31939 WP_003104412.1.32137 WP_003104412.1.32289 WP_003104412.1.32314 WP_003104412.1.32447 WP_003104412.1.32544 WP_003104412.1.32596 WP_003104412.1.32637 WP_003104412.1.32641 WP_003104412.1.32711 WP_003104412.1.32879 WP_003104412.1.33133 WP_003104412.1.33152 WP_003104412.1.33186 WP_003104412.1.33204 WP_003104412.1.33210 WP_003104412.1.33216 WP_003104412.1.33340 WP_003104412.1.33387 WP_003104412.1.33521 WP_003104412.1.33523 WP_003104412.1.33549 WP_003104412.1.33653 WP_003104412.1.33658 WP_003104412.1.33733 WP_003104412.1.33734 WP_003104412.1.3376 WP_003104412.1.33822 WP_003104412.1.33824 WP_003104412.1.34000 WP_003104412.1.34039 WP_003104412.1.34151 WP_003104412.1.34306 WP_003104412.1.34317 WP_003104412.1.34401 WP_003104412.1.34402 WP_003104412.1.3452 WP_003104412.1.34568 WP_003104412.1.34625 WP_003104412.1.34670 WP_003104412.1.34832 WP_003104412.1.34837 WP_003104412.1.34876 WP_003104412.1.34878 WP_003104412.1.34901 WP_003104412.1.35036 WP_003104412.1.35104 WP_003104412.1.35149 WP_003104412.1.35231 WP_003104412.1.35281 WP_003104412.1.3531 WP_003104412.1.35325 WP_003104412.1.35431 WP_003104412.1.35480 WP_003104412.1.35573 WP_003104412.1.35599 WP_003104412.1.35641 WP_003104412.1.35669 WP_003104412.1.35679 WP_003104412.1.35682 WP_003104412.1.3576 WP_003104412.1.35762 WP_003104412.1.35768 WP_003104412.1.35843 WP_003104412.1.35857 WP_003104412.1.35872 WP_003104412.1.35984 WP_003104412.1.36170 WP_003104412.1.36266 WP_003104412.1.36378 WP_003104412.1.36435 WP_003104412.1.36521 WP_003104412.1.36587 WP_003104412.1.36630 WP_003104412.1.36665 WP_003104412.1.36781 WP_003104412.1.36879 WP_003104412.1.37125 WP_003104412.1.37163 WP_003104412.1.3721 WP_003104412.1.37216 WP_003104412.1.37319 WP_003104412.1.37366 WP_003104412.1.37512 WP_003104412.1.3781 WP_003104412.1.37814 WP_003104412.1.37818 WP_003104412.1.37826 WP_003104412.1.37842 WP_003104412.1.3785 WP_003104412.1.38003 WP_003104412.1.38102 WP_003104412.1.38146 WP_003104412.1.38151 WP_003104412.1.38186 WP_003104412.1.38319 WP_003104412.1.3833 WP_003104412.1.38337 WP_003104412.1.38430 WP_003104412.1.38450 WP_003104412.1.38505 WP_003104412.1.38583 WP_003104412.1.38657 WP_003104412.1.38661 WP_003104412.1.3870 WP_003104412.1.38889 WP_003104412.1.38971 WP_003104412.1.39046 WP_003104412.1.39088 WP_003104412.1.39186 WP_003104412.1.39271 WP_003104412.1.39326 WP_003104412.1.39345 WP_003104412.1.3943 WP_003104412.1.39444 WP_003104412.1.39458 WP_003104412.1.39786 WP_003104412.1.39949 WP_003104412.1.3998 WP_003104412.1.40059 WP_003104412.1.40207 WP_003104412.1.40213 WP_003104412.1.40243 WP_003104412.1.40512 WP_003104412.1.40541 WP_003104412.1.4058 WP_003104412.1.40994 WP_003104412.1.41291 WP_003104412.1.41301 WP_003104412.1.41412 WP_003104412.1.41502 WP_003104412.1.4156 WP_003104412.1.41618 WP_003104412.1.41625 WP_003104412.1.41692 WP_003104412.1.41732 WP_003104412.1.41748 WP_003104412.1.41773 WP_003104412.1.41832 WP_003104412.1.41871 WP_003104412.1.41888 WP_003104412.1.4190 WP_003104412.1.42041 WP_003104412.1.42146 WP_003104412.1.42294 WP_003104412.1.42423 WP_003104412.1.42463 WP_003104412.1.42508 WP_003104412.1.42634 WP_003104412.1.42643 WP_003104412.1.42754 WP_003104412.1.42757 WP_003104412.1.42789 WP_003104412.1.42854 WP_003104412.1.42856 WP_003104412.1.42917 WP_003104412.1.42946 WP_003104412.1.42972 WP_003104412.1.43024 WP_003104412.1.43049 WP_003104412.1.43293 WP_003104412.1.43330 WP_003104412.1.43356 WP_003104412.1.4348 WP_003104412.1.43593 WP_003104412.1.43662 WP_003104412.1.43667 WP_003104412.1.43673 WP_003104412.1.43783 WP_003104412.1.43802 WP_003104412.1.4381 WP_003104412.1.43826 WP_003104412.1.4398 WP_003104412.1.44046 WP_003104412.1.44094 WP_003104412.1.44213 WP_003104412.1.44260 WP_003104412.1.44373 WP_003104412.1.445 WP_003104412.1.44581 WP_003104412.1.44739 WP_003104412.1.44760 WP_003104412.1.4493 WP_003104412.1.44959 WP_003104412.1.45090 WP_003104412.1.45146 WP_003104412.1.45199 WP_003104412.1.45202 WP_003104412.1.4522 WP_003104412.1.45312 WP_003104412.1.4532 WP_003104412.1.45328 WP_003104412.1.45358 WP_003104412.1.45464 WP_003104412.1.45478 WP_003104412.1.45485 WP_003104412.1.45723 WP_003104412.1.45920 WP_003104412.1.45934 WP_003104412.1.46010 WP_003104412.1.46032 WP_003104412.1.46093 WP_003104412.1.461 WP_003104412.1.46152 WP_003104412.1.46200 WP_003104412.1.46436 WP_003104412.1.46502 WP_003104412.1.46623 WP_003104412.1.46755 WP_003104412.1.46787 WP_003104412.1.46826 WP_003104412.1.46866 WP_003104412.1.46885 WP_003104412.1.46926 WP_003104412.1.4699 WP_003104412.1.47101 WP_003104412.1.47155 WP_003104412.1.47158 WP_003104412.1.47312 WP_003104412.1.47469 WP_003104412.1.47527 WP_003104412.1.47645 WP_003104412.1.47774 WP_003104412.1.47930 WP_003104412.1.47970 WP_003104412.1.48001 WP_003104412.1.48086 WP_003104412.1.48141 WP_003104412.1.48172 WP_003104412.1.48178 WP_003104412.1.48321 WP_003104412.1.48334 WP_003104412.1.48378 WP_003104412.1.48382 WP_003104412.1.48413 WP_003104412.1.48474 WP_003104412.1.48747 WP_003104412.1.48820 WP_003104412.1.48842 WP_003104412.1.49265 WP_003104412.1.49266 WP_003104412.1.49286 WP_003104412.1.49293 WP_003104412.1.49360 WP_003104412.1.49416 WP_003104412.1.49500 WP_003104412.1.49557 WP_003104412.1.49566 WP_003104412.1.49688 WP_003104412.1.49798 WP_003104412.1.49833 WP_003104412.1.49842 WP_003104412.1.49976 WP_003104412.1.49988 WP_003104412.1.49998 WP_003104412.1.50176 WP_003104412.1.50180 WP_003104412.1.50222 WP_003104412.1.50242 WP_003104412.1.5043 WP_003104412.1.50653 WP_003104412.1.50665 WP_003104412.1.50668 WP_003104412.1.50682 WP_003104412.1.50734 WP_003104412.1.50814 WP_003104412.1.50967 WP_003104412.1.50989 WP_003104412.1.51019 WP_003104412.1.51035 WP_003104412.1.51136 WP_003104412.1.51183 WP_003104412.1.51267 WP_003104412.1.51273 WP_003104412.1.51501 WP_003104412.1.51538 WP_003104412.1.51549 WP_003104412.1.51682 WP_003104412.1.51807 WP_003104412.1.51847 WP_003104412.1.51889 WP_003104412.1.51943 WP_003104412.1.51976 WP_003104412.1.52043 WP_003104412.1.52220 WP_003104412.1.52244 WP_003104412.1.5226 WP_003104412.1.52334 WP_003104412.1.5235 WP_003104412.1.52355 WP_003104412.1.52449 WP_003104412.1.52537 WP_003104412.1.5258 WP_003104412.1.52583 WP_003104412.1.5260 WP_003104412.1.52690 WP_003104412.1.52700 WP_003104412.1.52728 WP_003104412.1.52784 WP_003104412.1.5294 WP_003104412.1.53169 WP_003104412.1.53267 WP_003104412.1.53287 WP_003104412.1.53351 WP_003104412.1.53371 WP_003104412.1.53427 WP_003104412.1.53530 WP_003104412.1.53663 WP_003104412.1.53719 WP_003104412.1.53726 WP_003104412.1.53932 WP_003104412.1.53948 WP_003104412.1.5399 WP_003104412.1.54090 WP_003104412.1.54133 WP_003104412.1.54140 WP_003104412.1.54146 WP_003104412.1.5420 WP_003104412.1.54248 WP_003104412.1.54462 WP_003104412.1.54497 WP_003104412.1.54571 WP_003104412.1.54742 WP_003104412.1.54809 WP_003104412.1.54974 WP_003104412.1.55089 WP_003104412.1.55169 WP_003104412.1.55318 WP_003104412.1.55347 WP_003104412.1.55400 WP_003104412.1.55729 WP_003104412.1.55976 WP_003104412.1.56145 WP_003104412.1.56187 WP_003104412.1.56196 WP_003104412.1.56228 WP_003104412.1.56229 WP_003104412.1.56315 WP_003104412.1.56348 WP_003104412.1.56442 WP_003104412.1.56452 WP_003104412.1.56474 WP_003104412.1.56475 WP_003104412.1.56632 WP_003104412.1.56745 WP_003104412.1.56768 WP_003104412.1.56797 WP_003104412.1.56819 WP_003104412.1.56973 WP_003104412.1.57005 WP_003104412.1.57113 WP_003104412.1.57131 WP_003104412.1.57276 WP_003104412.1.5731 WP_003104412.1.57480 WP_003104412.1.57532 WP_003104412.1.57548 WP_003104412.1.57566 WP_003104412.1.57728 WP_003104412.1.58056 WP_003104412.1.58183 WP_003104412.1.58193 WP_003104412.1.58228 WP_003104412.1.58436 WP_003104412.1.58482 WP_003104412.1.58527 WP_003104412.1.58689 WP_003104412.1.58838 WP_003104412.1.58845 WP_003104412.1.59013 WP_003104412.1.59076 WP_003104412.1.59176 WP_003104412.1.59246 WP_003104412.1.59249 WP_003104412.1.59563 WP_003104412.1.59724 WP_003104412.1.59797 WP_003104412.1.59831 WP_003104412.1.59870 WP_003104412.1.60051 WP_003104412.1.60062 WP_003104412.1.60085 WP_003104412.1.60347 WP_003104412.1.60415 WP_003104412.1.60467 WP_003104412.1.60600 WP_003104412.1.60602 WP_003104412.1.60603 WP_003104412.1.60639 WP_003104412.1.60686 WP_003104412.1.607 WP_003104412.1.60910 WP_003104412.1.60916 WP_003104412.1.61122 WP_003104412.1.61130 WP_003104412.1.61209 WP_003104412.1.61222 WP_003104412.1.6130 WP_003104412.1.61431 WP_003104412.1.61493 WP_003104412.1.61549 WP_003104412.1.61598 WP_003104412.1.61696 WP_003104412.1.6173 WP_003104412.1.62010 WP_003104412.1.62180 WP_003104412.1.62186 WP_003104412.1.62211 WP_003104412.1.62357 WP_003104412.1.62410 WP_003104412.1.6242 WP_003104412.1.62483 WP_003104412.1.62516 WP_003104412.1.62534 WP_003104412.1.62701 WP_003104412.1.62704 WP_003104412.1.62716 WP_003104412.1.62768 WP_003104412.1.62772 WP_003104412.1.62834 WP_003104412.1.62873 WP_003104412.1.62917 WP_003104412.1.63041 WP_003104412.1.63057 WP_003104412.1.63193 WP_003104412.1.63196 WP_003104412.1.63338 WP_003104412.1.63597 WP_003104412.1.63634 WP_003104412.1.63659 WP_003104412.1.64139 WP_003104412.1.64155 WP_003104412.1.64329 WP_003104412.1.64591 WP_003104412.1.64603 WP_003104412.1.64726 WP_003104412.1.64748 WP_003104412.1.64799 WP_003104412.1.64807 WP_003104412.1.64854 WP_003104412.1.64862 WP_003104412.1.64880 WP_003104412.1.64983 WP_003104412.1.64984 WP_003104412.1.65009 WP_003104412.1.65066 WP_003104412.1.65095 WP_003104412.1.65099 WP_003104412.1.65145 WP_003104412.1.65196 WP_003104412.1.65227 WP_003104412.1.65247 WP_003104412.1.65304 WP_003104412.1.65316 WP_003104412.1.65337 WP_003104412.1.65549 WP_003104412.1.65642 WP_003104412.1.65740 WP_003104412.1.65819 WP_003104412.1.65867 WP_003104412.1.6589 WP_003104412.1.65926 WP_003104412.1.66165 WP_003104412.1.6629 WP_003104412.1.66364 WP_003104412.1.66371 WP_003104412.1.66526 WP_003104412.1.66634 WP_003104412.1.66721 WP_003104412.1.66892 WP_003104412.1.66929 WP_003104412.1.66950 WP_003104412.1.67188 WP_003104412.1.67205 WP_003104412.1.67261 WP_003104412.1.67269 WP_003104412.1.67370 WP_003104412.1.67388 WP_003104412.1.67472 WP_003104412.1.67526 WP_003104412.1.67531 WP_003104412.1.67545 WP_003104412.1.67686 WP_003104412.1.67755 WP_003104412.1.67830 WP_003104412.1.67903 WP_003104412.1.67948 WP_003104412.1.68183 WP_003104412.1.68252 WP_003104412.1.68317 WP_003104412.1.6850 WP_003104412.1.68541 WP_003104412.1.68568 WP_003104412.1.68638 WP_003104412.1.68756 WP_003104412.1.68781 WP_003104412.1.68850 WP_003104412.1.68857 WP_003104412.1.68862 WP_003104412.1.68910 WP_003104412.1.68938 WP_003104412.1.69159 WP_003104412.1.69260 WP_003104412.1.6928 WP_003104412.1.6937 WP_003104412.1.69556 WP_003104412.1.69599 WP_003104412.1.69702 WP_003104412.1.69834 WP_003104412.1.69907 WP_003104412.1.69993 WP_003104412.1.70092 WP_003104412.1.70098 WP_003104412.1.70194 WP_003104412.1.70229 WP_003104412.1.70470 WP_003104412.1.70561 WP_003104412.1.70648 WP_003104412.1.70670 WP_003104412.1.70693 WP_003104412.1.7077 WP_003104412.1.70778 WP_003104412.1.70991 WP_003104412.1.71038 WP_003104412.1.7128 WP_003104412.1.71385 WP_003104412.1.71570 WP_003104412.1.71642 WP_003104412.1.71799 WP_003104412.1.71806 WP_003104412.1.71822 WP_003104412.1.71891 WP_003104412.1.71934 WP_003104412.1.72167 WP_003104412.1.72181 WP_003104412.1.72287 WP_003104412.1.72323 WP_003104412.1.72331 WP_003104412.1.72346 WP_003104412.1.72458 WP_003104412.1.72541 WP_003104412.1.72562 WP_003104412.1.72570 WP_003104412.1.72653 WP_003104412.1.7276 WP_003104412.1.72768 WP_003104412.1.72772 WP_003104412.1.73048 WP_003104412.1.7308 WP_003104412.1.73149 WP_003104412.1.73172 WP_003104412.1.7327 WP_003104412.1.733 WP_003104412.1.73455 WP_003104412.1.73490 WP_003104412.1.73523 WP_003104412.1.73651 WP_003104412.1.73728 WP_003104412.1.73791 WP_003104412.1.7382 WP_003104412.1.73860 WP_003104412.1.73911 WP_003104412.1.74 WP_003104412.1.74000 WP_003104412.1.7408 WP_003104412.1.74167 WP_003104412.1.74175 WP_003104412.1.74182 WP_003104412.1.74219 WP_003104412.1.74264 WP_003104412.1.74268 WP_003104412.1.7445 WP_003104412.1.74458 WP_003104412.1.74473 WP_003104412.1.74518 WP_003104412.1.7456 WP_003104412.1.74568 WP_003104412.1.74604 WP_003104412.1.74629 WP_003104412.1.74776 WP_003104412.1.748 WP_003104412.1.74958 WP_003104412.1.75041 WP_003104412.1.75119 WP_003104412.1.75204 WP_003104412.1.75277 WP_003104412.1.75303 WP_003104412.1.7547 WP_003104412.1.75549 WP_003104412.1.75573 WP_003104412.1.75599 WP_003104412.1.75631 WP_003104412.1.75771 WP_003104412.1.75792 WP_003104412.1.75825 WP_003104412.1.75826 WP_003104412.1.75935 WP_003104412.1.75938 WP_003104412.1.75947 WP_003104412.1.7595 WP_003104412.1.76092 WP_003104412.1.76145 WP_003104412.1.76192 WP_003104412.1.76322 WP_003104412.1.76355 WP_003104412.1.76383 WP_003104412.1.76399 WP_003104412.1.76441 WP_003104412.1.76467 WP_003104412.1.76484 WP_003104412.1.76600 WP_003104412.1.76716 WP_003104412.1.76985 WP_003104412.1.77235 WP_003104412.1.77238 WP_003104412.1.77286 WP_003104412.1.77317 WP_003104412.1.77490 WP_003104412.1.77566 WP_003104412.1.77574 WP_003104412.1.77587 WP_003104412.1.77686 WP_003104412.1.77750 WP_003104412.1.77769 WP_003104412.1.77819 WP_003104412.1.77834 WP_003104412.1.78112 WP_003104412.1.78134 WP_003104412.1.78158 WP_003104412.1.78280 WP_003104412.1.78380 WP_003104412.1.78430 WP_003104412.1.78570 WP_003104412.1.78623 WP_003104412.1.78795 WP_003104412.1.78810 WP_003104412.1.78954 WP_003104412.1.78986 WP_003104412.1.79007 WP_003104412.1.79053 WP_003104412.1.79177 WP_003104412.1.79256 WP_003104412.1.79279 WP_003104412.1.79311 WP_003104412.1.79364 WP_003104412.1.79431 WP_003104412.1.79463 WP_003104412.1.7953 WP_003104412.1.79544 WP_003104412.1.79569 WP_003104412.1.79788 WP_003104412.1.79862 WP_003104412.1.79908 WP_003104412.1.79986 WP_003104412.1.80033 WP_003104412.1.80087 WP_003104412.1.80174 WP_003104412.1.8028 WP_003104412.1.80306 WP_003104412.1.80410 WP_003104412.1.80411 WP_003104412.1.80481 WP_003104412.1.8051 WP_003104412.1.80535 WP_003104412.1.80632 WP_003104412.1.8064 WP_003104412.1.80645 WP_003104412.1.80720 WP_003104412.1.80880 WP_003104412.1.80892 WP_003104412.1.80931 WP_003104412.1.80938 WP_003104412.1.81081 WP_003104412.1.81082 WP_003104412.1.8110 WP_003104412.1.81206 WP_003104412.1.81331 WP_003104412.1.81487 WP_003104412.1.81591 WP_003104412.1.81643 WP_003104412.1.81728 WP_003104412.1.81742 WP_003104412.1.81771 WP_003104412.1.81784 WP_003104412.1.81802 WP_003104412.1.81816 WP_003104412.1.81834 WP_003104412.1.81844 WP_003104412.1.81950 WP_003104412.1.81957 WP_003104412.1.81960 WP_003104412.1.81986 WP_003104412.1.82117 WP_003104412.1.82127 WP_003104412.1.82310 WP_003104412.1.82312 WP_003104412.1.82328 WP_003104412.1.82334 WP_003104412.1.82604 WP_003104412.1.82606 WP_003104412.1.82620 WP_003104412.1.8284 WP_003104412.1.82864 WP_003104412.1.82882 WP_003104412.1.83025 WP_003104412.1.83184 WP_003104412.1.83213 WP_003104412.1.83251 WP_003104412.1.83296 WP_003104412.1.83394 WP_003104412.1.835 WP_003104412.1.8353 WP_003104412.1.83534 WP_003104412.1.8357 WP_003104412.1.83698 WP_003104412.1.83946 WP_003104412.1.84003 WP_003104412.1.84008 WP_003104412.1.84174 WP_003104412.1.84190 WP_003104412.1.84271 WP_003104412.1.84297 WP_003104412.1.8437 WP_003104412.1.84374 WP_003104412.1.84398 WP_003104412.1.84404 WP_003104412.1.84439 WP_003104412.1.84471 WP_003104412.1.8453 WP_003104412.1.84589 WP_003104412.1.84674 WP_003104412.1.84702 WP_003104412.1.84715 WP_003104412.1.84754 WP_003104412.1.84792 WP_003104412.1.8484 WP_003104412.1.84937 WP_003104412.1.84946 WP_003104412.1.8498 WP_003104412.1.85028 WP_003104412.1.85059 WP_003104412.1.85290 WP_003104412.1.85303 WP_003104412.1.85318 WP_003104412.1.85574 WP_003104412.1.85633 WP_003104412.1.85788 WP_003104412.1.85897 WP_003104412.1.85910 WP_003104412.1.86002 WP_003104412.1.86058 WP_003104412.1.861 WP_003104412.1.86278 WP_003104412.1.86287 WP_003104412.1.86293 WP_003104412.1.86386 WP_003104412.1.865 WP_003104412.1.86545 WP_003104412.1.86552 WP_003104412.1.86652 WP_003104412.1.867 WP_003104412.1.86785 WP_003104412.1.86813 WP_003104412.1.86947 WP_003104412.1.86985 WP_003104412.1.87163 WP_003104412.1.8718 WP_003104412.1.87182 WP_003104412.1.8727 WP_003104412.1.87390 WP_003104412.1.87435 WP_003104412.1.8749 WP_003104412.1.87530 WP_003104412.1.87547 WP_003104412.1.87648 WP_003104412.1.87763 WP_003104412.1.87970 WP_003104412.1.87987 WP_003104412.1.88004 WP_003104412.1.88308 WP_003104412.1.88330 WP_003104412.1.88388 WP_003104412.1.88550 WP_003104412.1.88578 WP_003104412.1.88605 WP_003104412.1.88659 WP_003104412.1.88679 WP_003104412.1.88680 WP_003104412.1.88714 WP_003104412.1.88750 WP_003104412.1.88900 WP_003104412.1.8911 WP_003104412.1.89276 WP_003104412.1.89409 WP_003104412.1.89434 WP_003104412.1.89440 WP_003104412.1.89491 WP_003104412.1.89577 WP_003104412.1.89610 WP_003104412.1.89638 WP_003104412.1.89662 WP_003104412.1.89669 WP_003104412.1.89736 WP_003104412.1.8976 WP_003104412.1.89776 WP_003104412.1.89805 WP_003104412.1.89866 WP_003104412.1.89867 WP_003104412.1.89868 WP_003104412.1.89886 WP_003104412.1.90032 WP_003104412.1.90056 WP_003104412.1.90141 WP_003104412.1.90189 WP_003104412.1.90224 WP_003104412.1.90242 WP_003104412.1.90306 WP_003104412.1.90412 WP_003104412.1.9056 WP_003104412.1.90569 WP_003104412.1.90655 WP_003104412.1.90770 WP_003104412.1.90940 WP_003104412.1.91161 WP_003104412.1.9120 WP_003104412.1.91204 WP_003104412.1.91307 WP_003104412.1.91360 WP_003104412.1.91416 WP_003104412.1.9143 WP_003104412.1.91431 WP_003104412.1.91438 WP_003104412.1.91563 WP_003104412.1.91585 WP_003104412.1.9182 WP_003104412.1.91846 WP_003104412.1.91862 WP_003104412.1.9191 WP_003104412.1.92175 WP_003104412.1.92314 WP_003104412.1.92357 WP_003104412.1.92573 WP_003104412.1.92585 WP_003104412.1.92587 WP_003104412.1.92589 WP_003104412.1.92624 WP_003104412.1.9272 WP_003104412.1.92769 WP_003104412.1.92839 WP_003104412.1.92894 WP_003104412.1.93001 WP_003104412.1.93090 WP_003104412.1.93144 WP_003104412.1.93148 WP_003104412.1.9328 WP_003104412.1.93446 WP_003104412.1.9349 WP_003104412.1.93493 WP_003104412.1.93797 WP_003104412.1.94004 WP_003104412.1.94031 WP_003104412.1.94174 WP_003104412.1.94218 WP_003104412.1.94243 WP_003104412.1.94385 WP_003104412.1.94434 WP_003104412.1.9444 WP_003104412.1.94450 WP_003104412.1.94682 WP_003104412.1.94814 WP_003104412.1.94818 WP_003104412.1.94856 WP_003104412.1.94897 WP_003104412.1.95027 WP_003104412.1.95056 WP_003104412.1.95117 WP_003104412.1.95132 WP_003104412.1.95187 WP_003104412.1.95207 WP_003104412.1.95217 WP_003104412.1.95460 WP_003104412.1.95488 WP_003104412.1.95525 WP_003104412.1.95536 WP_003104412.1.95668 WP_003104412.1.95745 WP_003104412.1.95751 WP_003104412.1.95774 WP_003104412.1.95787 WP_003104412.1.95802 WP_003104412.1.95820 WP_003104412.1.95825 WP_003104412.1.9599 WP_003104412.1.95994 WP_003104412.1.95999 WP_003104412.1.96008 WP_003104412.1.9604 WP_003104412.1.96041 WP_003104412.1.96134 WP_003104412.1.96193 WP_003104412.1.96243 WP_003104412.1.96267 WP_003104412.1.96434 WP_003104412.1.96506 WP_003104412.1.96967 WP_003104412.1.9706 WP_003104412.1.97118 WP_003104412.1.97126 WP_003104412.1.97213 WP_003104412.1.9722 WP_003104412.1.97271 WP_003104412.1.97272 WP_003104412.1.97474 WP_003104412.1.97614 WP_003104412.1.97826 WP_003104412.1.97877 WP_003104412.1.97968 WP_003104412.1.98260 WP_003104412.1.98276 WP_003104412.1.98410 WP_003104412.1.98414 WP_003104412.1.98433 WP_003104412.1.98522 WP_003104412.1.98573 WP_003104412.1.98600 WP_003104412.1.98610 WP_003104412.1.98672 WP_003104412.1.98693 WP_003104412.1.98788 WP_003104412.1.98814 WP_003104412.1.9885 WP_003104412.1.98926 WP_003104412.1.98958 WP_003104412.1.98960 WP_003104412.1.99068 WP_003104412.1.99103 WP_003104412.1.99293 WP_003104412.1.99353 WP_003104412.1.99461 WP_003104412.1.9951 WP_003104412.1.99654 WP_003104412.1.99662 WP_003104412.1.99746 WP_003104412.1.99757 WP_003104412.1.99795 WP_003104412.1.99835 WP_003104412.1.9989 WP_003104412.1.99930 gi|392984967|ref|YP_006483554.1| gi|558671039|ref|YP_008807749.1| gi|558677390|ref|YP_008814098.1| 208964.PA1568 557722.PLES_37601

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]