SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|568155663|ref|YP_008944654.1| from Pseudomonas aeruginosa LES431

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|568155663|ref|YP_008944654.1|
Domain Number 1 Region: 7-142
Classification Level Classification E-value
Superfamily YjgF-like 4.08e-45
Family YjgF/L-PSP 0.0011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|568155663|ref|YP_008944654.1|
Sequence length 144
Comment LysR family transcriptional regulator [Pseudomonas aeruginosa LES431]
Sequence
MQTSPAPAIVAGGAYQPVVLHAGIAYVSGQLPRQHGELRWTGKVGSELDLEQARQAARLC
AARCLQALEEALGGLQRVERLLKVTGYVASAAGFVQQPAVIDAASEYFDEVLGARGGHAR
AAVGVAELPRGAAVEVELIAAVRP
Download sequence
Identical sequences A0A0H3QXB9 A0A1E9BWU2 A0A1G5EEQ5 A0A231INB6 V6AKP5
gi|392985704|ref|YP_006484291.1| gi|218893242|ref|YP_002442111.1| gi|558670204|ref|YP_008806914.1| gi|386060284|ref|YP_005976806.1| gi|568155663|ref|YP_008944654.1| WP_003116494.1.100071 WP_003116494.1.100319 WP_003116494.1.100420 WP_003116494.1.100456 WP_003116494.1.100469 WP_003116494.1.100473 WP_003116494.1.100742 WP_003116494.1.100810 WP_003116494.1.101090 WP_003116494.1.101310 WP_003116494.1.101340 WP_003116494.1.101506 WP_003116494.1.101590 WP_003116494.1.101642 WP_003116494.1.101712 WP_003116494.1.101739 WP_003116494.1.10174 WP_003116494.1.10179 WP_003116494.1.101819 WP_003116494.1.101871 WP_003116494.1.10202 WP_003116494.1.10204 WP_003116494.1.102045 WP_003116494.1.10228 WP_003116494.1.10257 WP_003116494.1.10419 WP_003116494.1.10435 WP_003116494.1.10457 WP_003116494.1.10513 WP_003116494.1.10529 WP_003116494.1.10572 WP_003116494.1.10856 WP_003116494.1.11026 WP_003116494.1.11058 WP_003116494.1.1107 WP_003116494.1.11077 WP_003116494.1.11130 WP_003116494.1.11163 WP_003116494.1.11178 WP_003116494.1.11180 WP_003116494.1.11569 WP_003116494.1.11653 WP_003116494.1.11744 WP_003116494.1.1180 WP_003116494.1.1183 WP_003116494.1.11847 WP_003116494.1.1187 WP_003116494.1.11943 WP_003116494.1.12208 WP_003116494.1.12354 WP_003116494.1.1238 WP_003116494.1.12497 WP_003116494.1.12530 WP_003116494.1.12561 WP_003116494.1.12660 WP_003116494.1.12687 WP_003116494.1.12797 WP_003116494.1.12838 WP_003116494.1.12873 WP_003116494.1.12890 WP_003116494.1.12891 WP_003116494.1.12970 WP_003116494.1.12980 WP_003116494.1.13 WP_003116494.1.13057 WP_003116494.1.13077 WP_003116494.1.13208 WP_003116494.1.13232 WP_003116494.1.13315 WP_003116494.1.1333 WP_003116494.1.13364 WP_003116494.1.13407 WP_003116494.1.13529 WP_003116494.1.1356 WP_003116494.1.1362 WP_003116494.1.13622 WP_003116494.1.13642 WP_003116494.1.13758 WP_003116494.1.13765 WP_003116494.1.13795 WP_003116494.1.1393 WP_003116494.1.14096 WP_003116494.1.14116 WP_003116494.1.14378 WP_003116494.1.14424 WP_003116494.1.14564 WP_003116494.1.14679 WP_003116494.1.14690 WP_003116494.1.14714 WP_003116494.1.1475 WP_003116494.1.14754 WP_003116494.1.14820 WP_003116494.1.14835 WP_003116494.1.14839 WP_003116494.1.14966 WP_003116494.1.15004 WP_003116494.1.152 WP_003116494.1.15222 WP_003116494.1.15231 WP_003116494.1.15281 WP_003116494.1.15373 WP_003116494.1.15408 WP_003116494.1.15474 WP_003116494.1.15602 WP_003116494.1.15666 WP_003116494.1.15692 WP_003116494.1.15886 WP_003116494.1.15889 WP_003116494.1.15934 WP_003116494.1.16041 WP_003116494.1.162 WP_003116494.1.16239 WP_003116494.1.16419 WP_003116494.1.1646 WP_003116494.1.16694 WP_003116494.1.1670 WP_003116494.1.1671 WP_003116494.1.16788 WP_003116494.1.16801 WP_003116494.1.16895 WP_003116494.1.17155 WP_003116494.1.17353 WP_003116494.1.17354 WP_003116494.1.17370 WP_003116494.1.1739 WP_003116494.1.17499 WP_003116494.1.17697 WP_003116494.1.17883 WP_003116494.1.17890 WP_003116494.1.1824 WP_003116494.1.18349 WP_003116494.1.18547 WP_003116494.1.18732 WP_003116494.1.18892 WP_003116494.1.190 WP_003116494.1.19260 WP_003116494.1.19552 WP_003116494.1.19591 WP_003116494.1.19711 WP_003116494.1.19741 WP_003116494.1.19771 WP_003116494.1.19931 WP_003116494.1.20024 WP_003116494.1.20125 WP_003116494.1.20134 WP_003116494.1.20590 WP_003116494.1.20744 WP_003116494.1.20764 WP_003116494.1.20854 WP_003116494.1.20884 WP_003116494.1.209 WP_003116494.1.21002 WP_003116494.1.21242 WP_003116494.1.21349 WP_003116494.1.21448 WP_003116494.1.21469 WP_003116494.1.21517 WP_003116494.1.21607 WP_003116494.1.21782 WP_003116494.1.21863 WP_003116494.1.21871 WP_003116494.1.21891 WP_003116494.1.21932 WP_003116494.1.22078 WP_003116494.1.221 WP_003116494.1.2228 WP_003116494.1.22324 WP_003116494.1.22365 WP_003116494.1.22389 WP_003116494.1.22394 WP_003116494.1.22442 WP_003116494.1.22477 WP_003116494.1.22491 WP_003116494.1.22573 WP_003116494.1.22704 WP_003116494.1.22729 WP_003116494.1.22863 WP_003116494.1.22891 WP_003116494.1.23013 WP_003116494.1.23195 WP_003116494.1.2323 WP_003116494.1.23331 WP_003116494.1.23394 WP_003116494.1.23512 WP_003116494.1.23523 WP_003116494.1.23525 WP_003116494.1.23559 WP_003116494.1.23581 WP_003116494.1.23611 WP_003116494.1.23641 WP_003116494.1.23715 WP_003116494.1.23769 WP_003116494.1.23782 WP_003116494.1.23794 WP_003116494.1.23961 WP_003116494.1.24066 WP_003116494.1.24077 WP_003116494.1.24087 WP_003116494.1.24351 WP_003116494.1.24447 WP_003116494.1.2453 WP_003116494.1.24662 WP_003116494.1.2477 WP_003116494.1.24851 WP_003116494.1.24938 WP_003116494.1.25052 WP_003116494.1.25067 WP_003116494.1.25075 WP_003116494.1.251 WP_003116494.1.25109 WP_003116494.1.25142 WP_003116494.1.25149 WP_003116494.1.25179 WP_003116494.1.25191 WP_003116494.1.2529 WP_003116494.1.25348 WP_003116494.1.2535 WP_003116494.1.25532 WP_003116494.1.25641 WP_003116494.1.25695 WP_003116494.1.2572 WP_003116494.1.25964 WP_003116494.1.26025 WP_003116494.1.261 WP_003116494.1.26159 WP_003116494.1.26301 WP_003116494.1.26428 WP_003116494.1.26463 WP_003116494.1.2652 WP_003116494.1.26539 WP_003116494.1.26592 WP_003116494.1.26681 WP_003116494.1.26682 WP_003116494.1.26705 WP_003116494.1.26740 WP_003116494.1.26816 WP_003116494.1.26841 WP_003116494.1.26906 WP_003116494.1.2698 WP_003116494.1.27018 WP_003116494.1.27028 WP_003116494.1.27107 WP_003116494.1.27211 WP_003116494.1.27259 WP_003116494.1.27288 WP_003116494.1.27534 WP_003116494.1.27549 WP_003116494.1.27575 WP_003116494.1.27587 WP_003116494.1.27687 WP_003116494.1.27738 WP_003116494.1.27837 WP_003116494.1.27858 WP_003116494.1.28057 WP_003116494.1.28136 WP_003116494.1.28316 WP_003116494.1.28372 WP_003116494.1.28468 WP_003116494.1.28528 WP_003116494.1.28560 WP_003116494.1.28602 WP_003116494.1.28838 WP_003116494.1.28849 WP_003116494.1.28920 WP_003116494.1.29062 WP_003116494.1.29070 WP_003116494.1.29096 WP_003116494.1.29137 WP_003116494.1.29179 WP_003116494.1.29208 WP_003116494.1.2927 WP_003116494.1.29401 WP_003116494.1.29498 WP_003116494.1.29577 WP_003116494.1.2961 WP_003116494.1.29650 WP_003116494.1.29753 WP_003116494.1.29767 WP_003116494.1.29848 WP_003116494.1.30020 WP_003116494.1.3030 WP_003116494.1.30475 WP_003116494.1.30567 WP_003116494.1.30614 WP_003116494.1.30707 WP_003116494.1.30797 WP_003116494.1.30842 WP_003116494.1.30886 WP_003116494.1.30973 WP_003116494.1.30994 WP_003116494.1.31076 WP_003116494.1.31087 WP_003116494.1.31103 WP_003116494.1.31105 WP_003116494.1.31138 WP_003116494.1.31147 WP_003116494.1.31279 WP_003116494.1.31633 WP_003116494.1.31741 WP_003116494.1.31751 WP_003116494.1.3179 WP_003116494.1.31848 WP_003116494.1.31852 WP_003116494.1.3189 WP_003116494.1.32144 WP_003116494.1.32235 WP_003116494.1.32289 WP_003116494.1.32544 WP_003116494.1.32596 WP_003116494.1.32626 WP_003116494.1.32637 WP_003116494.1.32711 WP_003116494.1.32879 WP_003116494.1.33133 WP_003116494.1.33152 WP_003116494.1.33210 WP_003116494.1.33216 WP_003116494.1.33455 WP_003116494.1.33517 WP_003116494.1.33521 WP_003116494.1.33523 WP_003116494.1.33549 WP_003116494.1.33653 WP_003116494.1.33728 WP_003116494.1.33733 WP_003116494.1.33734 WP_003116494.1.3376 WP_003116494.1.33814 WP_003116494.1.33822 WP_003116494.1.34000 WP_003116494.1.34136 WP_003116494.1.34150 WP_003116494.1.34191 WP_003116494.1.34306 WP_003116494.1.34401 WP_003116494.1.34402 WP_003116494.1.34472 WP_003116494.1.34670 WP_003116494.1.34689 WP_003116494.1.34784 WP_003116494.1.34821 WP_003116494.1.34832 WP_003116494.1.34836 WP_003116494.1.34837 WP_003116494.1.34876 WP_003116494.1.34878 WP_003116494.1.34901 WP_003116494.1.35036 WP_003116494.1.35149 WP_003116494.1.35231 WP_003116494.1.3531 WP_003116494.1.35431 WP_003116494.1.35529 WP_003116494.1.3555 WP_003116494.1.35573 WP_003116494.1.35599 WP_003116494.1.35639 WP_003116494.1.35641 WP_003116494.1.35679 WP_003116494.1.3576 WP_003116494.1.35762 WP_003116494.1.35768 WP_003116494.1.35843 WP_003116494.1.35857 WP_003116494.1.35872 WP_003116494.1.35984 WP_003116494.1.36170 WP_003116494.1.36266 WP_003116494.1.36285 WP_003116494.1.36378 WP_003116494.1.36435 WP_003116494.1.36521 WP_003116494.1.36587 WP_003116494.1.36630 WP_003116494.1.36665 WP_003116494.1.36879 WP_003116494.1.37125 WP_003116494.1.37163 WP_003116494.1.3721 WP_003116494.1.37216 WP_003116494.1.37319 WP_003116494.1.37366 WP_003116494.1.3742 WP_003116494.1.37500 WP_003116494.1.3781 WP_003116494.1.37814 WP_003116494.1.37842 WP_003116494.1.38087 WP_003116494.1.38102 WP_003116494.1.38146 WP_003116494.1.38151 WP_003116494.1.3821 WP_003116494.1.3833 WP_003116494.1.38335 WP_003116494.1.38337 WP_003116494.1.38430 WP_003116494.1.38505 WP_003116494.1.38583 WP_003116494.1.38661 WP_003116494.1.38706 WP_003116494.1.38889 WP_003116494.1.38971 WP_003116494.1.39088 WP_003116494.1.39186 WP_003116494.1.39345 WP_003116494.1.39444 WP_003116494.1.39452 WP_003116494.1.39458 WP_003116494.1.39704 WP_003116494.1.39786 WP_003116494.1.39949 WP_003116494.1.39989 WP_003116494.1.40135 WP_003116494.1.40207 WP_003116494.1.40243 WP_003116494.1.40271 WP_003116494.1.40419 WP_003116494.1.40512 WP_003116494.1.40546 WP_003116494.1.4058 WP_003116494.1.40874 WP_003116494.1.40950 WP_003116494.1.41137 WP_003116494.1.41199 WP_003116494.1.41301 WP_003116494.1.41412 WP_003116494.1.41487 WP_003116494.1.41502 WP_003116494.1.41692 WP_003116494.1.41732 WP_003116494.1.41748 WP_003116494.1.41832 WP_003116494.1.41846 WP_003116494.1.41888 WP_003116494.1.4190 WP_003116494.1.42041 WP_003116494.1.42146 WP_003116494.1.42423 WP_003116494.1.42463 WP_003116494.1.42508 WP_003116494.1.42634 WP_003116494.1.42643 WP_003116494.1.42690 WP_003116494.1.42723 WP_003116494.1.4273 WP_003116494.1.42757 WP_003116494.1.42778 WP_003116494.1.42854 WP_003116494.1.42856 WP_003116494.1.42946 WP_003116494.1.42972 WP_003116494.1.43024 WP_003116494.1.43212 WP_003116494.1.43326 WP_003116494.1.43356 WP_003116494.1.43593 WP_003116494.1.43603 WP_003116494.1.43662 WP_003116494.1.43667 WP_003116494.1.43783 WP_003116494.1.43802 WP_003116494.1.4381 WP_003116494.1.43826 WP_003116494.1.4398 WP_003116494.1.44046 WP_003116494.1.44213 WP_003116494.1.44260 WP_003116494.1.44269 WP_003116494.1.44373 WP_003116494.1.44434 WP_003116494.1.445 WP_003116494.1.44552 WP_003116494.1.44581 WP_003116494.1.44739 WP_003116494.1.44804 WP_003116494.1.44870 WP_003116494.1.4493 WP_003116494.1.44959 WP_003116494.1.45090 WP_003116494.1.45199 WP_003116494.1.45306 WP_003116494.1.45358 WP_003116494.1.45464 WP_003116494.1.45485 WP_003116494.1.45611 WP_003116494.1.45818 WP_003116494.1.45920 WP_003116494.1.45934 WP_003116494.1.45946 WP_003116494.1.46010 WP_003116494.1.46093 WP_003116494.1.461 WP_003116494.1.46152 WP_003116494.1.46200 WP_003116494.1.4640 WP_003116494.1.46755 WP_003116494.1.46787 WP_003116494.1.46866 WP_003116494.1.46885 WP_003116494.1.46926 WP_003116494.1.4699 WP_003116494.1.47101 WP_003116494.1.47155 WP_003116494.1.4726 WP_003116494.1.47469 WP_003116494.1.47527 WP_003116494.1.47551 WP_003116494.1.47645 WP_003116494.1.47774 WP_003116494.1.47930 WP_003116494.1.47970 WP_003116494.1.48086 WP_003116494.1.48094 WP_003116494.1.48141 WP_003116494.1.48178 WP_003116494.1.48334 WP_003116494.1.48378 WP_003116494.1.48382 WP_003116494.1.48579 WP_003116494.1.48820 WP_003116494.1.48840 WP_003116494.1.48842 WP_003116494.1.49265 WP_003116494.1.49266 WP_003116494.1.49286 WP_003116494.1.49293 WP_003116494.1.49360 WP_003116494.1.49500 WP_003116494.1.49557 WP_003116494.1.49566 WP_003116494.1.49688 WP_003116494.1.49798 WP_003116494.1.49842 WP_003116494.1.49948 WP_003116494.1.49976 WP_003116494.1.49998 WP_003116494.1.50180 WP_003116494.1.50222 WP_003116494.1.50242 WP_003116494.1.5043 WP_003116494.1.50450 WP_003116494.1.50665 WP_003116494.1.50668 WP_003116494.1.50682 WP_003116494.1.50814 WP_003116494.1.50967 WP_003116494.1.50989 WP_003116494.1.51019 WP_003116494.1.51035 WP_003116494.1.51136 WP_003116494.1.51173 WP_003116494.1.51183 WP_003116494.1.51185 WP_003116494.1.51267 WP_003116494.1.51273 WP_003116494.1.5132 WP_003116494.1.51549 WP_003116494.1.51682 WP_003116494.1.51807 WP_003116494.1.51847 WP_003116494.1.51889 WP_003116494.1.51943 WP_003116494.1.52043 WP_003116494.1.52220 WP_003116494.1.52244 WP_003116494.1.52326 WP_003116494.1.52355 WP_003116494.1.52372 WP_003116494.1.52403 WP_003116494.1.52409 WP_003116494.1.5258 WP_003116494.1.52583 WP_003116494.1.52591 WP_003116494.1.5260 WP_003116494.1.52690 WP_003116494.1.52697 WP_003116494.1.52700 WP_003116494.1.52728 WP_003116494.1.52784 WP_003116494.1.52939 WP_003116494.1.53070 WP_003116494.1.53267 WP_003116494.1.53287 WP_003116494.1.53351 WP_003116494.1.53371 WP_003116494.1.53486 WP_003116494.1.53528 WP_003116494.1.53530 WP_003116494.1.53586 WP_003116494.1.53663 WP_003116494.1.53932 WP_003116494.1.53946 WP_003116494.1.54076 WP_003116494.1.54133 WP_003116494.1.5420 WP_003116494.1.54462 WP_003116494.1.54497 WP_003116494.1.54809 WP_003116494.1.55 WP_003116494.1.55089 WP_003116494.1.55169 WP_003116494.1.55318 WP_003116494.1.55400 WP_003116494.1.55543 WP_003116494.1.55729 WP_003116494.1.56145 WP_003116494.1.56196 WP_003116494.1.56315 WP_003116494.1.56452 WP_003116494.1.56623 WP_003116494.1.56632 WP_003116494.1.56797 WP_003116494.1.56808 WP_003116494.1.56819 WP_003116494.1.56973 WP_003116494.1.57065 WP_003116494.1.57131 WP_003116494.1.57276 WP_003116494.1.57532 WP_003116494.1.57548 WP_003116494.1.57921 WP_003116494.1.58183 WP_003116494.1.58193 WP_003116494.1.58228 WP_003116494.1.58436 WP_003116494.1.58482 WP_003116494.1.58527 WP_003116494.1.58581 WP_003116494.1.58689 WP_003116494.1.58838 WP_003116494.1.58845 WP_003116494.1.5889 WP_003116494.1.5897 WP_003116494.1.59076 WP_003116494.1.59099 WP_003116494.1.59246 WP_003116494.1.59249 WP_003116494.1.59250 WP_003116494.1.59385 WP_003116494.1.59724 WP_003116494.1.59759 WP_003116494.1.59797 WP_003116494.1.59943 WP_003116494.1.60062 WP_003116494.1.60206 WP_003116494.1.60261 WP_003116494.1.60347 WP_003116494.1.60415 WP_003116494.1.60467 WP_003116494.1.60600 WP_003116494.1.60603 WP_003116494.1.60639 WP_003116494.1.60686 WP_003116494.1.607 WP_003116494.1.60910 WP_003116494.1.60916 WP_003116494.1.61122 WP_003116494.1.61130 WP_003116494.1.61209 WP_003116494.1.61222 WP_003116494.1.61269 WP_003116494.1.6130 WP_003116494.1.61431 WP_003116494.1.61493 WP_003116494.1.61549 WP_003116494.1.616 WP_003116494.1.61943 WP_003116494.1.62010 WP_003116494.1.62035 WP_003116494.1.62180 WP_003116494.1.62410 WP_003116494.1.6242 WP_003116494.1.62483 WP_003116494.1.62534 WP_003116494.1.62604 WP_003116494.1.62635 WP_003116494.1.62701 WP_003116494.1.62768 WP_003116494.1.62772 WP_003116494.1.6283 WP_003116494.1.62873 WP_003116494.1.62917 WP_003116494.1.62961 WP_003116494.1.63124 WP_003116494.1.63597 WP_003116494.1.63634 WP_003116494.1.63659 WP_003116494.1.63929 WP_003116494.1.63941 WP_003116494.1.64139 WP_003116494.1.64155 WP_003116494.1.64198 WP_003116494.1.64309 WP_003116494.1.64340 WP_003116494.1.64591 WP_003116494.1.64605 WP_003116494.1.64748 WP_003116494.1.64799 WP_003116494.1.64807 WP_003116494.1.64862 WP_003116494.1.64880 WP_003116494.1.64885 WP_003116494.1.64983 WP_003116494.1.64984 WP_003116494.1.65009 WP_003116494.1.65095 WP_003116494.1.65099 WP_003116494.1.65145 WP_003116494.1.65196 WP_003116494.1.65197 WP_003116494.1.65247 WP_003116494.1.65304 WP_003116494.1.65316 WP_003116494.1.65334 WP_003116494.1.65337 WP_003116494.1.65478 WP_003116494.1.65549 WP_003116494.1.65642 WP_003116494.1.65740 WP_003116494.1.65867 WP_003116494.1.6589 WP_003116494.1.65926 WP_003116494.1.66088 WP_003116494.1.66165 WP_003116494.1.66277 WP_003116494.1.6629 WP_003116494.1.66348 WP_003116494.1.66364 WP_003116494.1.66371 WP_003116494.1.66526 WP_003116494.1.66634 WP_003116494.1.66693 WP_003116494.1.66892 WP_003116494.1.66929 WP_003116494.1.66931 WP_003116494.1.66950 WP_003116494.1.67124 WP_003116494.1.67205 WP_003116494.1.67261 WP_003116494.1.67269 WP_003116494.1.67370 WP_003116494.1.67388 WP_003116494.1.67472 WP_003116494.1.67526 WP_003116494.1.67531 WP_003116494.1.67545 WP_003116494.1.67686 WP_003116494.1.67830 WP_003116494.1.67874 WP_003116494.1.67948 WP_003116494.1.6796 WP_003116494.1.68000 WP_003116494.1.6808 WP_003116494.1.68158 WP_003116494.1.68252 WP_003116494.1.68317 WP_003116494.1.68446 WP_003116494.1.68448 WP_003116494.1.6850 WP_003116494.1.68541 WP_003116494.1.68568 WP_003116494.1.6866 WP_003116494.1.68756 WP_003116494.1.68800 WP_003116494.1.68850 WP_003116494.1.68862 WP_003116494.1.68910 WP_003116494.1.68938 WP_003116494.1.69159 WP_003116494.1.69260 WP_003116494.1.6928 WP_003116494.1.69556 WP_003116494.1.69702 WP_003116494.1.69819 WP_003116494.1.69834 WP_003116494.1.69907 WP_003116494.1.69993 WP_003116494.1.70098 WP_003116494.1.70561 WP_003116494.1.70648 WP_003116494.1.70650 WP_003116494.1.70670 WP_003116494.1.70693 WP_003116494.1.7077 WP_003116494.1.70778 WP_003116494.1.70831 WP_003116494.1.71038 WP_003116494.1.71290 WP_003116494.1.71385 WP_003116494.1.71570 WP_003116494.1.71610 WP_003116494.1.71666 WP_003116494.1.71799 WP_003116494.1.71806 WP_003116494.1.71822 WP_003116494.1.71934 WP_003116494.1.72167 WP_003116494.1.7219 WP_003116494.1.72287 WP_003116494.1.72331 WP_003116494.1.72346 WP_003116494.1.72458 WP_003116494.1.72541 WP_003116494.1.72562 WP_003116494.1.72570 WP_003116494.1.72653 WP_003116494.1.72662 WP_003116494.1.7276 WP_003116494.1.72768 WP_003116494.1.72772 WP_003116494.1.72782 WP_003116494.1.73035 WP_003116494.1.73048 WP_003116494.1.7308 WP_003116494.1.73135 WP_003116494.1.73149 WP_003116494.1.73172 WP_003116494.1.7327 WP_003116494.1.73490 WP_003116494.1.73601 WP_003116494.1.73651 WP_003116494.1.73728 WP_003116494.1.73791 WP_003116494.1.7382 WP_003116494.1.73860 WP_003116494.1.73911 WP_003116494.1.73941 WP_003116494.1.74 WP_003116494.1.74072 WP_003116494.1.74182 WP_003116494.1.74219 WP_003116494.1.74268 WP_003116494.1.7445 WP_003116494.1.74458 WP_003116494.1.74473 WP_003116494.1.7456 WP_003116494.1.74568 WP_003116494.1.74604 WP_003116494.1.748 WP_003116494.1.74958 WP_003116494.1.7501 WP_003116494.1.75119 WP_003116494.1.75277 WP_003116494.1.75303 WP_003116494.1.7547 WP_003116494.1.75549 WP_003116494.1.75573 WP_003116494.1.7568 WP_003116494.1.75756 WP_003116494.1.75825 WP_003116494.1.75826 WP_003116494.1.75935 WP_003116494.1.75938 WP_003116494.1.75947 WP_003116494.1.7595 WP_003116494.1.76092 WP_003116494.1.76145 WP_003116494.1.76355 WP_003116494.1.76383 WP_003116494.1.76441 WP_003116494.1.76467 WP_003116494.1.76484 WP_003116494.1.76543 WP_003116494.1.76600 WP_003116494.1.76716 WP_003116494.1.76791 WP_003116494.1.76985 WP_003116494.1.77235 WP_003116494.1.77238 WP_003116494.1.77286 WP_003116494.1.77317 WP_003116494.1.77442 WP_003116494.1.77574 WP_003116494.1.77587 WP_003116494.1.77769 WP_003116494.1.7779 WP_003116494.1.77834 WP_003116494.1.78134 WP_003116494.1.78158 WP_003116494.1.78280 WP_003116494.1.78430 WP_003116494.1.78437 WP_003116494.1.78570 WP_003116494.1.78599 WP_003116494.1.78693 WP_003116494.1.78795 WP_003116494.1.78810 WP_003116494.1.78954 WP_003116494.1.79003 WP_003116494.1.79007 WP_003116494.1.79060 WP_003116494.1.79177 WP_003116494.1.79193 WP_003116494.1.79256 WP_003116494.1.79279 WP_003116494.1.79311 WP_003116494.1.79364 WP_003116494.1.7953 WP_003116494.1.79544 WP_003116494.1.79569 WP_003116494.1.79601 WP_003116494.1.79631 WP_003116494.1.79788 WP_003116494.1.79908 WP_003116494.1.79986 WP_003116494.1.80033 WP_003116494.1.80087 WP_003116494.1.80174 WP_003116494.1.8028 WP_003116494.1.80410 WP_003116494.1.80632 WP_003116494.1.8064 WP_003116494.1.80715 WP_003116494.1.80846 WP_003116494.1.80880 WP_003116494.1.80892 WP_003116494.1.80926 WP_003116494.1.80931 WP_003116494.1.80938 WP_003116494.1.81081 WP_003116494.1.81082 WP_003116494.1.8110 WP_003116494.1.81331 WP_003116494.1.81349 WP_003116494.1.8141 WP_003116494.1.81487 WP_003116494.1.81581 WP_003116494.1.81622 WP_003116494.1.81643 WP_003116494.1.81784 WP_003116494.1.81816 WP_003116494.1.81834 WP_003116494.1.81844 WP_003116494.1.81950 WP_003116494.1.81986 WP_003116494.1.82127 WP_003116494.1.82260 WP_003116494.1.82310 WP_003116494.1.82312 WP_003116494.1.82328 WP_003116494.1.82334 WP_003116494.1.82604 WP_003116494.1.82606 WP_003116494.1.82620 WP_003116494.1.82643 WP_003116494.1.82798 WP_003116494.1.82810 WP_003116494.1.8284 WP_003116494.1.82882 WP_003116494.1.83025 WP_003116494.1.83131 WP_003116494.1.83184 WP_003116494.1.83213 WP_003116494.1.83251 WP_003116494.1.83296 WP_003116494.1.835 WP_003116494.1.8351 WP_003116494.1.83534 WP_003116494.1.8357 WP_003116494.1.83715 WP_003116494.1.83871 WP_003116494.1.83937 WP_003116494.1.84003 WP_003116494.1.84008 WP_003116494.1.84174 WP_003116494.1.84190 WP_003116494.1.84203 WP_003116494.1.84271 WP_003116494.1.84297 WP_003116494.1.8437 WP_003116494.1.84374 WP_003116494.1.84398 WP_003116494.1.84404 WP_003116494.1.84487 WP_003116494.1.8453 WP_003116494.1.84538 WP_003116494.1.84702 WP_003116494.1.84754 WP_003116494.1.84825 WP_003116494.1.8484 WP_003116494.1.84937 WP_003116494.1.8498 WP_003116494.1.85018 WP_003116494.1.85059 WP_003116494.1.85318 WP_003116494.1.85574 WP_003116494.1.85633 WP_003116494.1.85897 WP_003116494.1.85910 WP_003116494.1.86002 WP_003116494.1.86058 WP_003116494.1.861 WP_003116494.1.86243 WP_003116494.1.86278 WP_003116494.1.86287 WP_003116494.1.8645 WP_003116494.1.86506 WP_003116494.1.86545 WP_003116494.1.86552 WP_003116494.1.86595 WP_003116494.1.86652 WP_003116494.1.867 WP_003116494.1.86708 WP_003116494.1.86733 WP_003116494.1.86785 WP_003116494.1.86813 WP_003116494.1.86822 WP_003116494.1.86985 WP_003116494.1.87104 WP_003116494.1.87163 WP_003116494.1.8718 WP_003116494.1.87182 WP_003116494.1.87390 WP_003116494.1.87435 WP_003116494.1.8749 WP_003116494.1.87530 WP_003116494.1.87970 WP_003116494.1.87987 WP_003116494.1.88004 WP_003116494.1.88308 WP_003116494.1.88388 WP_003116494.1.88680 WP_003116494.1.88714 WP_003116494.1.88750 WP_003116494.1.88949 WP_003116494.1.8911 WP_003116494.1.89234 WP_003116494.1.89266 WP_003116494.1.89434 WP_003116494.1.89440 WP_003116494.1.8949 WP_003116494.1.89491 WP_003116494.1.89577 WP_003116494.1.89610 WP_003116494.1.89638 WP_003116494.1.89669 WP_003116494.1.89736 WP_003116494.1.8976 WP_003116494.1.89805 WP_003116494.1.89867 WP_003116494.1.89868 WP_003116494.1.89886 WP_003116494.1.90024 WP_003116494.1.90032 WP_003116494.1.90110 WP_003116494.1.90189 WP_003116494.1.90224 WP_003116494.1.90242 WP_003116494.1.90272 WP_003116494.1.90306 WP_003116494.1.90412 WP_003116494.1.90569 WP_003116494.1.90655 WP_003116494.1.90770 WP_003116494.1.91012 WP_003116494.1.91093 WP_003116494.1.91236 WP_003116494.1.91360 WP_003116494.1.91416 WP_003116494.1.9143 WP_003116494.1.91431 WP_003116494.1.91438 WP_003116494.1.91585 WP_003116494.1.9182 WP_003116494.1.91846 WP_003116494.1.91860 WP_003116494.1.91862 WP_003116494.1.91882 WP_003116494.1.9191 WP_003116494.1.92321 WP_003116494.1.92357 WP_003116494.1.92573 WP_003116494.1.92585 WP_003116494.1.92589 WP_003116494.1.92624 WP_003116494.1.92759 WP_003116494.1.92769 WP_003116494.1.92839 WP_003116494.1.93090 WP_003116494.1.93144 WP_003116494.1.93148 WP_003116494.1.93196 WP_003116494.1.93250 WP_003116494.1.9328 WP_003116494.1.93446 WP_003116494.1.9349 WP_003116494.1.93520 WP_003116494.1.93797 WP_003116494.1.93848 WP_003116494.1.94004 WP_003116494.1.94031 WP_003116494.1.94174 WP_003116494.1.94218 WP_003116494.1.94243 WP_003116494.1.94285 WP_003116494.1.94288 WP_003116494.1.94385 WP_003116494.1.94434 WP_003116494.1.9444 WP_003116494.1.94682 WP_003116494.1.94814 WP_003116494.1.94818 WP_003116494.1.94881 WP_003116494.1.94896 WP_003116494.1.94897 WP_003116494.1.95027 WP_003116494.1.95056 WP_003116494.1.95117 WP_003116494.1.95132 WP_003116494.1.95187 WP_003116494.1.95305 WP_003116494.1.95324 WP_003116494.1.95460 WP_003116494.1.95525 WP_003116494.1.95536 WP_003116494.1.95668 WP_003116494.1.95745 WP_003116494.1.95751 WP_003116494.1.95774 WP_003116494.1.95787 WP_003116494.1.95802 WP_003116494.1.9599 WP_003116494.1.95994 WP_003116494.1.95999 WP_003116494.1.96008 WP_003116494.1.9604 WP_003116494.1.96041 WP_003116494.1.96134 WP_003116494.1.96193 WP_003116494.1.96267 WP_003116494.1.96357 WP_003116494.1.96506 WP_003116494.1.96667 WP_003116494.1.96863 WP_003116494.1.96880 WP_003116494.1.9706 WP_003116494.1.97118 WP_003116494.1.97126 WP_003116494.1.97213 WP_003116494.1.9722 WP_003116494.1.97271 WP_003116494.1.97272 WP_003116494.1.97474 WP_003116494.1.97503 WP_003116494.1.97614 WP_003116494.1.97784 WP_003116494.1.97968 WP_003116494.1.98308 WP_003116494.1.98410 WP_003116494.1.98414 WP_003116494.1.98522 WP_003116494.1.98610 WP_003116494.1.98672 WP_003116494.1.98693 WP_003116494.1.98814 WP_003116494.1.9885 WP_003116494.1.98960 WP_003116494.1.99214 WP_003116494.1.99293 WP_003116494.1.99386 WP_003116494.1.99461 WP_003116494.1.99757 WP_003116494.1.99795 WP_003116494.1.99835 WP_003116494.1.99930 gi|568311442|ref|YP_008983711.1| 557722.PLES_45281 gi|558676555|ref|YP_008813263.1| gi|386064489|ref|YP_005979793.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]