SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|568155915|ref|YP_008944907.1| from Pseudomonas aeruginosa LES431

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|568155915|ref|YP_008944907.1|
Domain Number 1 Region: 7-186
Classification Level Classification E-value
Superfamily Cobalamin adenosyltransferase-like 1.45e-59
Family Cobalamin adenosyltransferase 0.0000141
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|568155915|ref|YP_008944907.1|
Sequence length 192
Comment ATP--cobalamin adenosyltransferase [Pseudomonas aeruginosa LES431]
Sequence
MGNRLSKIYTRTGDRGETGLAGGRRVPKSHPRIEAIGAVDELNSQLGLLLAELLEARGAH
PGLEEIVQALAPVQHRLFDLGGELAMPEYRALDETEVARLESCIDRWNDELGPLKNFILP
GGSRLVAQAHVCRSLARSAERRCQALDQEETLEGVGLCYLNRLSDLLFVAARAIARRQGV
AEILWEAAAKPD
Download sequence
Identical sequences A0A1E9C287 A0A1F0IMF4
gi|568155915|ref|YP_008944907.1| WP_003106516.1.100071 WP_003106516.1.100420 WP_003106516.1.100523 WP_003106516.1.100654 WP_003106516.1.100786 WP_003106516.1.100810 WP_003106516.1.100872 WP_003106516.1.100995 WP_003106516.1.101572 WP_003106516.1.101712 WP_003106516.1.101739 WP_003106516.1.101863 WP_003106516.1.10201 WP_003106516.1.10202 WP_003106516.1.102045 WP_003106516.1.10228 WP_003106516.1.10257 WP_003106516.1.1037 WP_003106516.1.10419 WP_003106516.1.10457 WP_003106516.1.10468 WP_003106516.1.10477 WP_003106516.1.10572 WP_003106516.1.10641 WP_003106516.1.10901 WP_003106516.1.11026 WP_003106516.1.11077 WP_003106516.1.11163 WP_003106516.1.11381 WP_003106516.1.11410 WP_003106516.1.11568 WP_003106516.1.11653 WP_003106516.1.11744 WP_003106516.1.1180 WP_003106516.1.11847 WP_003106516.1.11943 WP_003106516.1.12120 WP_003106516.1.12240 WP_003106516.1.12302 WP_003106516.1.12482 WP_003106516.1.12530 WP_003106516.1.12561 WP_003106516.1.12873 WP_003106516.1.12891 WP_003106516.1.12922 WP_003106516.1.12970 WP_003106516.1.13 WP_003106516.1.1305 WP_003106516.1.13057 WP_003106516.1.13232 WP_003106516.1.13315 WP_003106516.1.1333 WP_003106516.1.1356 WP_003106516.1.1362 WP_003106516.1.13622 WP_003106516.1.13765 WP_003106516.1.13785 WP_003106516.1.14078 WP_003106516.1.14460 WP_003106516.1.14640 WP_003106516.1.14714 WP_003106516.1.1475 WP_003106516.1.14820 WP_003106516.1.14835 WP_003106516.1.14839 WP_003106516.1.14966 WP_003106516.1.15004 WP_003106516.1.15130 WP_003106516.1.15373 WP_003106516.1.15474 WP_003106516.1.15485 WP_003106516.1.15602 WP_003106516.1.15889 WP_003106516.1.15934 WP_003106516.1.16109 WP_003106516.1.16197 WP_003106516.1.16267 WP_003106516.1.16279 WP_003106516.1.16419 WP_003106516.1.1646 WP_003106516.1.1671 WP_003106516.1.16782 WP_003106516.1.16788 WP_003106516.1.16801 WP_003106516.1.17022 WP_003106516.1.1739 WP_003106516.1.17566 WP_003106516.1.17697 WP_003106516.1.17883 WP_003106516.1.17890 WP_003106516.1.18052 WP_003106516.1.18204 WP_003106516.1.18234 WP_003106516.1.1824 WP_003106516.1.18493 WP_003106516.1.18728 WP_003106516.1.18769 WP_003106516.1.18852 WP_003106516.1.18930 WP_003106516.1.190 WP_003106516.1.19251 WP_003106516.1.19269 WP_003106516.1.19703 WP_003106516.1.19711 WP_003106516.1.19771 WP_003106516.1.20070 WP_003106516.1.20125 WP_003106516.1.20744 WP_003106516.1.20764 WP_003106516.1.20884 WP_003106516.1.209 WP_003106516.1.20929 WP_003106516.1.21242 WP_003106516.1.21302 WP_003106516.1.21349 WP_003106516.1.21448 WP_003106516.1.21469 WP_003106516.1.21471 WP_003106516.1.21517 WP_003106516.1.21607 WP_003106516.1.2172 WP_003106516.1.21744 WP_003106516.1.21932 WP_003106516.1.2228 WP_003106516.1.22365 WP_003106516.1.22389 WP_003106516.1.22394 WP_003106516.1.22442 WP_003106516.1.22863 WP_003106516.1.2289 WP_003106516.1.22891 WP_003106516.1.23195 WP_003106516.1.2323 WP_003106516.1.23331 WP_003106516.1.23418 WP_003106516.1.23525 WP_003106516.1.23581 WP_003106516.1.23641 WP_003106516.1.23715 WP_003106516.1.23739 WP_003106516.1.23782 WP_003106516.1.23884 WP_003106516.1.23925 WP_003106516.1.23961 WP_003106516.1.23967 WP_003106516.1.23983 WP_003106516.1.24066 WP_003106516.1.24101 WP_003106516.1.24351 WP_003106516.1.24851 WP_003106516.1.24869 WP_003106516.1.25033 WP_003106516.1.251 WP_003106516.1.25109 WP_003106516.1.25142 WP_003106516.1.25149 WP_003106516.1.25271 WP_003106516.1.25348 WP_003106516.1.2535 WP_003106516.1.25532 WP_003106516.1.25695 WP_003106516.1.25964 WP_003106516.1.261 WP_003106516.1.26334 WP_003106516.1.26539 WP_003106516.1.26592 WP_003106516.1.26604 WP_003106516.1.26682 WP_003106516.1.26967 WP_003106516.1.27018 WP_003106516.1.27534 WP_003106516.1.27575 WP_003106516.1.27587 WP_003106516.1.27738 WP_003106516.1.27837 WP_003106516.1.27858 WP_003106516.1.27939 WP_003106516.1.28006 WP_003106516.1.28258 WP_003106516.1.28404 WP_003106516.1.28468 WP_003106516.1.28560 WP_003106516.1.28623 WP_003106516.1.28823 WP_003106516.1.28849 WP_003106516.1.28920 WP_003106516.1.29062 WP_003106516.1.29096 WP_003106516.1.29208 WP_003106516.1.2927 WP_003106516.1.29401 WP_003106516.1.29498 WP_003106516.1.2980 WP_003106516.1.30000 WP_003106516.1.30365 WP_003106516.1.30567 WP_003106516.1.30625 WP_003106516.1.30707 WP_003106516.1.30886 WP_003106516.1.30994 WP_003106516.1.31045 WP_003106516.1.31076 WP_003106516.1.31087 WP_003106516.1.31103 WP_003106516.1.31105 WP_003106516.1.31138 WP_003106516.1.31147 WP_003106516.1.31279 WP_003106516.1.31361 WP_003106516.1.31565 WP_003106516.1.31587 WP_003106516.1.31848 WP_003106516.1.31939 WP_003106516.1.32544 WP_003106516.1.32637 WP_003106516.1.32879 WP_003106516.1.33133 WP_003106516.1.33152 WP_003106516.1.33186 WP_003106516.1.33204 WP_003106516.1.33210 WP_003106516.1.33216 WP_003106516.1.33387 WP_003106516.1.33658 WP_003106516.1.33733 WP_003106516.1.33774 WP_003106516.1.33822 WP_003106516.1.34000 WP_003106516.1.34039 WP_003106516.1.34151 WP_003106516.1.34191 WP_003106516.1.34306 WP_003106516.1.34401 WP_003106516.1.34402 WP_003106516.1.34625 WP_003106516.1.34670 WP_003106516.1.34832 WP_003106516.1.35325 WP_003106516.1.35573 WP_003106516.1.35599 WP_003106516.1.35641 WP_003106516.1.35669 WP_003106516.1.35679 WP_003106516.1.35682 WP_003106516.1.3576 WP_003106516.1.35768 WP_003106516.1.35843 WP_003106516.1.35857 WP_003106516.1.35872 WP_003106516.1.36170 WP_003106516.1.36378 WP_003106516.1.36521 WP_003106516.1.36587 WP_003106516.1.36630 WP_003106516.1.3672 WP_003106516.1.36781 WP_003106516.1.37163 WP_003106516.1.3721 WP_003106516.1.37216 WP_003106516.1.37319 WP_003106516.1.37814 WP_003106516.1.37826 WP_003106516.1.37842 WP_003106516.1.38003 WP_003106516.1.38102 WP_003106516.1.38146 WP_003106516.1.38151 WP_003106516.1.38186 WP_003106516.1.38319 WP_003106516.1.3833 WP_003106516.1.38430 WP_003106516.1.38505 WP_003106516.1.38583 WP_003106516.1.38657 WP_003106516.1.38661 WP_003106516.1.3870 WP_003106516.1.38889 WP_003106516.1.38971 WP_003106516.1.39046 WP_003106516.1.39088 WP_003106516.1.39186 WP_003106516.1.39271 WP_003106516.1.39444 WP_003106516.1.39458 WP_003106516.1.39786 WP_003106516.1.39949 WP_003106516.1.3998 WP_003106516.1.40213 WP_003106516.1.40243 WP_003106516.1.40512 WP_003106516.1.40541 WP_003106516.1.40994 WP_003106516.1.41291 WP_003106516.1.41301 WP_003106516.1.41384 WP_003106516.1.41412 WP_003106516.1.41502 WP_003106516.1.41618 WP_003106516.1.41625 WP_003106516.1.41732 WP_003106516.1.41748 WP_003106516.1.41832 WP_003106516.1.41888 WP_003106516.1.4190 WP_003106516.1.42146 WP_003106516.1.42259 WP_003106516.1.42294 WP_003106516.1.42463 WP_003106516.1.42634 WP_003106516.1.42757 WP_003106516.1.42778 WP_003106516.1.42856 WP_003106516.1.42946 WP_003106516.1.43026 WP_003106516.1.43293 WP_003106516.1.4348 WP_003106516.1.43603 WP_003106516.1.43662 WP_003106516.1.43667 WP_003106516.1.43673 WP_003106516.1.4381 WP_003106516.1.43826 WP_003106516.1.4398 WP_003106516.1.44094 WP_003106516.1.44260 WP_003106516.1.44373 WP_003106516.1.445 WP_003106516.1.44581 WP_003106516.1.44760 WP_003106516.1.44959 WP_003106516.1.45090 WP_003106516.1.45146 WP_003106516.1.45202 WP_003106516.1.45328 WP_003106516.1.45464 WP_003106516.1.45478 WP_003106516.1.45485 WP_003106516.1.45723 WP_003106516.1.45934 WP_003106516.1.46010 WP_003106516.1.46032 WP_003106516.1.461 WP_003106516.1.46152 WP_003106516.1.46436 WP_003106516.1.46502 WP_003106516.1.46623 WP_003106516.1.46755 WP_003106516.1.46885 WP_003106516.1.46926 WP_003106516.1.4699 WP_003106516.1.47101 WP_003106516.1.47155 WP_003106516.1.47158 WP_003106516.1.47296 WP_003106516.1.47645 WP_003106516.1.47774 WP_003106516.1.48001 WP_003106516.1.48024 WP_003106516.1.48086 WP_003106516.1.48172 WP_003106516.1.48378 WP_003106516.1.48545 WP_003106516.1.48576 WP_003106516.1.48820 WP_003106516.1.48842 WP_003106516.1.49265 WP_003106516.1.49416 WP_003106516.1.49500 WP_003106516.1.49688 WP_003106516.1.49798 WP_003106516.1.49833 WP_003106516.1.49998 WP_003106516.1.50176 WP_003106516.1.5043 WP_003106516.1.50734 WP_003106516.1.50814 WP_003106516.1.50967 WP_003106516.1.50989 WP_003106516.1.51019 WP_003106516.1.51035 WP_003106516.1.51273 WP_003106516.1.51457 WP_003106516.1.51501 WP_003106516.1.51538 WP_003106516.1.51585 WP_003106516.1.51682 WP_003106516.1.51807 WP_003106516.1.51847 WP_003106516.1.51976 WP_003106516.1.52043 WP_003106516.1.52220 WP_003106516.1.52244 WP_003106516.1.52334 WP_003106516.1.5235 WP_003106516.1.52449 WP_003106516.1.52537 WP_003106516.1.5258 WP_003106516.1.52583 WP_003106516.1.52690 WP_003106516.1.52697 WP_003106516.1.52700 WP_003106516.1.52784 WP_003106516.1.53371 WP_003106516.1.53427 WP_003106516.1.53530 WP_003106516.1.53719 WP_003106516.1.53726 WP_003106516.1.53932 WP_003106516.1.53948 WP_003106516.1.54090 WP_003106516.1.54140 WP_003106516.1.54146 WP_003106516.1.54462 WP_003106516.1.54497 WP_003106516.1.54809 WP_003106516.1.54974 WP_003106516.1.55089 WP_003106516.1.55169 WP_003106516.1.55543 WP_003106516.1.56145 WP_003106516.1.56229 WP_003106516.1.56315 WP_003106516.1.56348 WP_003106516.1.56452 WP_003106516.1.56745 WP_003106516.1.56768 WP_003106516.1.56797 WP_003106516.1.56819 WP_003106516.1.56973 WP_003106516.1.57113 WP_003106516.1.57276 WP_003106516.1.57480 WP_003106516.1.57548 WP_003106516.1.58056 WP_003106516.1.58183 WP_003106516.1.58193 WP_003106516.1.58228 WP_003106516.1.58482 WP_003106516.1.58689 WP_003106516.1.58838 WP_003106516.1.58845 WP_003106516.1.59013 WP_003106516.1.59076 WP_003106516.1.59176 WP_003106516.1.59246 WP_003106516.1.59759 WP_003106516.1.59831 WP_003106516.1.59870 WP_003106516.1.60051 WP_003106516.1.60062 WP_003106516.1.60415 WP_003106516.1.60602 WP_003106516.1.60603 WP_003106516.1.60639 WP_003106516.1.60686 WP_003106516.1.60916 WP_003106516.1.61122 WP_003106516.1.61130 WP_003106516.1.61209 WP_003106516.1.6130 WP_003106516.1.61598 WP_003106516.1.61696 WP_003106516.1.62010 WP_003106516.1.62410 WP_003106516.1.62483 WP_003106516.1.62516 WP_003106516.1.62534 WP_003106516.1.62701 WP_003106516.1.62768 WP_003106516.1.6280 WP_003106516.1.62873 WP_003106516.1.62917 WP_003106516.1.63041 WP_003106516.1.63057 WP_003106516.1.63193 WP_003106516.1.63196 WP_003106516.1.63597 WP_003106516.1.63634 WP_003106516.1.64329 WP_003106516.1.64726 WP_003106516.1.64807 WP_003106516.1.64854 WP_003106516.1.64862 WP_003106516.1.64984 WP_003106516.1.65009 WP_003106516.1.65099 WP_003106516.1.65145 WP_003106516.1.65227 WP_003106516.1.65237 WP_003106516.1.65316 WP_003106516.1.65337 WP_003106516.1.65549 WP_003106516.1.65642 WP_003106516.1.65819 WP_003106516.1.65926 WP_003106516.1.6629 WP_003106516.1.66364 WP_003106516.1.66371 WP_003106516.1.66526 WP_003106516.1.66929 WP_003106516.1.66950 WP_003106516.1.67188 WP_003106516.1.67192 WP_003106516.1.67205 WP_003106516.1.67261 WP_003106516.1.67269 WP_003106516.1.67370 WP_003106516.1.67388 WP_003106516.1.67472 WP_003106516.1.67526 WP_003106516.1.67686 WP_003106516.1.67755 WP_003106516.1.67830 WP_003106516.1.68000 WP_003106516.1.68162 WP_003106516.1.68252 WP_003106516.1.6850 WP_003106516.1.68541 WP_003106516.1.68568 WP_003106516.1.68756 WP_003106516.1.68781 WP_003106516.1.68850 WP_003106516.1.68862 WP_003106516.1.68910 WP_003106516.1.68938 WP_003106516.1.69088 WP_003106516.1.69159 WP_003106516.1.69260 WP_003106516.1.69599 WP_003106516.1.69702 WP_003106516.1.69834 WP_003106516.1.69907 WP_003106516.1.69993 WP_003106516.1.70092 WP_003106516.1.70194 WP_003106516.1.70229 WP_003106516.1.70470 WP_003106516.1.70561 WP_003106516.1.70648 WP_003106516.1.70670 WP_003106516.1.7077 WP_003106516.1.70778 WP_003106516.1.70991 WP_003106516.1.71038 WP_003106516.1.7128 WP_003106516.1.71385 WP_003106516.1.71642 WP_003106516.1.71891 WP_003106516.1.72167 WP_003106516.1.72181 WP_003106516.1.72287 WP_003106516.1.72331 WP_003106516.1.72458 WP_003106516.1.72541 WP_003106516.1.72653 WP_003106516.1.7276 WP_003106516.1.72768 WP_003106516.1.72772 WP_003106516.1.73048 WP_003106516.1.7308 WP_003106516.1.73149 WP_003106516.1.7327 WP_003106516.1.733 WP_003106516.1.73490 WP_003106516.1.73523 WP_003106516.1.73791 WP_003106516.1.7382 WP_003106516.1.73911 WP_003106516.1.74 WP_003106516.1.74000 WP_003106516.1.74072 WP_003106516.1.74106 WP_003106516.1.74175 WP_003106516.1.74182 WP_003106516.1.74219 WP_003106516.1.74458 WP_003106516.1.74473 WP_003106516.1.74568 WP_003106516.1.74629 WP_003106516.1.748 WP_003106516.1.74941 WP_003106516.1.74958 WP_003106516.1.75119 WP_003106516.1.75204 WP_003106516.1.7547 WP_003106516.1.75549 WP_003106516.1.75573 WP_003106516.1.75599 WP_003106516.1.75631 WP_003106516.1.75825 WP_003106516.1.7595 WP_003106516.1.76484 WP_003106516.1.76600 WP_003106516.1.76633 WP_003106516.1.76716 WP_003106516.1.76791 WP_003106516.1.77235 WP_003106516.1.77238 WP_003106516.1.77317 WP_003106516.1.77819 WP_003106516.1.77834 WP_003106516.1.78112 WP_003106516.1.78380 WP_003106516.1.78430 WP_003106516.1.78570 WP_003106516.1.78623 WP_003106516.1.78947 WP_003106516.1.78954 WP_003106516.1.79053 WP_003106516.1.79279 WP_003106516.1.79311 WP_003106516.1.79364 WP_003106516.1.79429 WP_003106516.1.79431 WP_003106516.1.79463 WP_003106516.1.7953 WP_003106516.1.79569 WP_003106516.1.79788 WP_003106516.1.79862 WP_003106516.1.79986 WP_003106516.1.80033 WP_003106516.1.80087 WP_003106516.1.80306 WP_003106516.1.80410 WP_003106516.1.80411 WP_003106516.1.80481 WP_003106516.1.8051 WP_003106516.1.80535 WP_003106516.1.80627 WP_003106516.1.8064 WP_003106516.1.80720 WP_003106516.1.81081 WP_003106516.1.8110 WP_003106516.1.81206 WP_003106516.1.81331 WP_003106516.1.81591 WP_003106516.1.81742 WP_003106516.1.81802 WP_003106516.1.81816 WP_003106516.1.81844 WP_003106516.1.81950 WP_003106516.1.82310 WP_003106516.1.82312 WP_003106516.1.82643 WP_003106516.1.82882 WP_003106516.1.83184 WP_003106516.1.83213 WP_003106516.1.83251 WP_003106516.1.83296 WP_003106516.1.83394 WP_003106516.1.835 WP_003106516.1.8357 WP_003106516.1.83637 WP_003106516.1.83946 WP_003106516.1.84008 WP_003106516.1.84174 WP_003106516.1.84177 WP_003106516.1.84190 WP_003106516.1.84271 WP_003106516.1.84297 WP_003106516.1.84374 WP_003106516.1.84439 WP_003106516.1.8453 WP_003106516.1.84702 WP_003106516.1.84754 WP_003106516.1.84792 WP_003106516.1.85290 WP_003106516.1.85318 WP_003106516.1.85897 WP_003106516.1.86058 WP_003106516.1.86278 WP_003106516.1.86287 WP_003106516.1.86293 WP_003106516.1.86386 WP_003106516.1.86545 WP_003106516.1.86552 WP_003106516.1.86947 WP_003106516.1.86985 WP_003106516.1.87163 WP_003106516.1.8718 WP_003106516.1.8727 WP_003106516.1.87316 WP_003106516.1.87435 WP_003106516.1.87530 WP_003106516.1.87648 WP_003106516.1.87763 WP_003106516.1.87981 WP_003106516.1.88004 WP_003106516.1.88308 WP_003106516.1.88330 WP_003106516.1.88517 WP_003106516.1.88578 WP_003106516.1.88659 WP_003106516.1.88679 WP_003106516.1.88714 WP_003106516.1.89098 WP_003106516.1.89245 WP_003106516.1.89276 WP_003106516.1.89409 WP_003106516.1.89491 WP_003106516.1.89577 WP_003106516.1.89610 WP_003106516.1.89662 WP_003106516.1.89736 WP_003106516.1.8976 WP_003106516.1.89805 WP_003106516.1.89866 WP_003106516.1.89868 WP_003106516.1.89886 WP_003106516.1.90056 WP_003106516.1.90242 WP_003106516.1.90306 WP_003106516.1.90412 WP_003106516.1.9056 WP_003106516.1.90569 WP_003106516.1.90770 WP_003106516.1.90940 WP_003106516.1.91093 WP_003106516.1.91161 WP_003106516.1.9120 WP_003106516.1.9143 WP_003106516.1.91431 WP_003106516.1.91438 WP_003106516.1.91563 WP_003106516.1.9182 WP_003106516.1.92314 WP_003106516.1.92573 WP_003106516.1.92587 WP_003106516.1.92589 WP_003106516.1.92769 WP_003106516.1.92894 WP_003106516.1.92924 WP_003106516.1.9328 WP_003106516.1.93493 WP_003106516.1.93797 WP_003106516.1.94004 WP_003106516.1.94218 WP_003106516.1.94385 WP_003106516.1.94434 WP_003106516.1.94450 WP_003106516.1.94682 WP_003106516.1.94897 WP_003106516.1.95025 WP_003106516.1.95027 WP_003106516.1.95056 WP_003106516.1.95117 WP_003106516.1.95132 WP_003106516.1.95187 WP_003106516.1.95207 WP_003106516.1.95460 WP_003106516.1.95525 WP_003106516.1.95745 WP_003106516.1.95751 WP_003106516.1.95802 WP_003106516.1.95820 WP_003106516.1.95825 WP_003106516.1.9599 WP_003106516.1.96243 WP_003106516.1.96267 WP_003106516.1.96434 WP_003106516.1.96702 WP_003106516.1.96967 WP_003106516.1.97118 WP_003106516.1.97126 WP_003106516.1.97213 WP_003106516.1.9722 WP_003106516.1.97271 WP_003106516.1.97474 WP_003106516.1.97614 WP_003106516.1.97877 WP_003106516.1.97968 WP_003106516.1.98260 WP_003106516.1.98410 WP_003106516.1.98414 WP_003106516.1.98433 WP_003106516.1.98522 WP_003106516.1.98573 WP_003106516.1.98610 WP_003106516.1.98672 WP_003106516.1.98678 WP_003106516.1.98788 WP_003106516.1.98926 WP_003106516.1.99103 WP_003106516.1.99662 WP_003106516.1.99746 WP_003106516.1.99757 WP_003106516.1.99795 gi|558668227|ref|YP_008804937.1| gi|218893490|ref|YP_002442359.1| 557722.PLES_47781 gi|392985963|ref|YP_006484550.1| gi|558674578|ref|YP_008811286.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]