SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|568155939|ref|YP_008944931.1| from Pseudomonas aeruginosa LES431

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|568155939|ref|YP_008944931.1|
Domain Number 1 Region: 251-419,447-599
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like I 2.75e-82
Family L-arabinose binding protein-like 0.0000199
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|568155939|ref|YP_008944931.1|
Sequence length 604
Comment hypothetical protein T223_24530 [Pseudomonas aeruginosa LES431]
Sequence
MIACLRPLSALILAGLLTACATSSNSGLGELPRTPNASIEQLLQQASQSKPEEAALLRLS
AADLAYQQKDLARSTAILGQIPLESLKPAQQVFASTLNAELALARSKPKAALQALQHPSM
QHLSELPVTQQVRTQRAKAQALAADGQVLAAAKERIYFAPLLEGPAVIENQEKIWTLVSS
LPVDQLQPSANEGDLSGWLTLARITKTSPTLQQQQASIESWQQQNPEHPAAKHLPAALEK
LKSLSQQPLTRIALLLPQQGQLANVARALQDGFLAAHFQAQQAGQNPPSIKLYDSTQVRS
LDDFYRQAQADGVELVVGPLEKPLVKQLASREQLPITTLALNYSDNSQEGPAQLFQFGLA
AEDEARAVASRAWGDGMRRAVALVPRGEWGDRVLAAFSQSWQSAGGSLIAAEHVDQPVQL
AQQIADLLQLRQSEGRAQRLQGALGSQIATQPSRRQDIDFVFLAATPQQARQIKPTLAFQ
YAGDLPVYATSHLYTGTNNPTQDQDLNGIRFCETPWLLNPSDPTRQQVAAQWPQANGSMG
RLYAMGVDAYRLAPRLPELKAVPSLQIDGLTGTLSLNPTQRIERQLQWAEFRNGQVQPLG
TSSF
Download sequence
Identical sequences gi|218893514|ref|YP_002442383.1| 557722.PLES_48021 WP_012614522.1.11026 WP_012614522.1.11943 WP_012614522.1.13232 WP_012614522.1.14714 WP_012614522.1.1475 WP_012614522.1.1646 WP_012614522.1.21517 WP_012614522.1.21607 WP_012614522.1.22863 WP_012614522.1.23195 WP_012614522.1.23715 WP_012614522.1.24351 WP_012614522.1.251 WP_012614522.1.25142 WP_012614522.1.26428 WP_012614522.1.27587 WP_012614522.1.27837 WP_012614522.1.28258 WP_012614522.1.31279 WP_012614522.1.32544 WP_012614522.1.33210 WP_012614522.1.34832 WP_012614522.1.35857 WP_012614522.1.37319 WP_012614522.1.3833 WP_012614522.1.38430 WP_012614522.1.38971 WP_012614522.1.39088 WP_012614522.1.43662 WP_012614522.1.45090 WP_012614522.1.45478 WP_012614522.1.45485 WP_012614522.1.45934 WP_012614522.1.46152 WP_012614522.1.47774 WP_012614522.1.51847 WP_012614522.1.52690 WP_012614522.1.53371 WP_012614522.1.56745 WP_012614522.1.56797 WP_012614522.1.59076 WP_012614522.1.60415 WP_012614522.1.60603 WP_012614522.1.61696 WP_012614522.1.62516 WP_012614522.1.62534 WP_012614522.1.62701 WP_012614522.1.6280 WP_012614522.1.65099 WP_012614522.1.66526 WP_012614522.1.67388 WP_012614522.1.67686 WP_012614522.1.68862 WP_012614522.1.72331 WP_012614522.1.73149 WP_012614522.1.7547 WP_012614522.1.78430 WP_012614522.1.81487 WP_012614522.1.84374 WP_012614522.1.86545 WP_012614522.1.86985 WP_012614522.1.87163 WP_012614522.1.87435 WP_012614522.1.91431 WP_012614522.1.92769 WP_012614522.1.92924 WP_012614522.1.95460 WP_012614522.1.9722 WP_012614522.1.99461 WP_012614522.1.99757 gi|568155939|ref|YP_008944931.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]