SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|568156609|ref|YP_008945601.1| from Pseudomonas aeruginosa LES431

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|568156609|ref|YP_008945601.1|
Domain Number 1 Region: 4-115
Classification Level Classification E-value
Superfamily YjgF-like 6.6e-31
Family YjgF/L-PSP 0.0013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|568156609|ref|YP_008945601.1|
Sequence length 116
Comment cytochrome C2 [Pseudomonas aeruginosa LES431]
Sequence
MEPTRIATNDRLSAAVCFDALVFLSGQVPGQAEDIHGQTREVLAKIDALLAEAGSRKERI
LSATIYLKDIARDFAALNEVWTQWLPTGQAPSRTTVQAELARPSVLVEITVVAARG
Download sequence
Identical sequences A0A069Q0R8 A0A0H2ZIG6 A0A0H3QR48 A0A157Z1J1 A0A1C7C2L7 A0A1E9C751 A0A1F0I887 A0A1G5I3F9 A0A1S1C0X8 Q9HUA0 V6AN99 W1MS82
gi|392986760|ref|YP_006485347.1| 208963.PA14_67140 208964.PA5083 557722.PLES_54731 gi|558668920|ref|YP_008805630.1| gi|386063398|ref|YP_005978702.1| gi|116053229|ref|YP_793552.1| gi|386061256|ref|YP_005977778.1| gi|568156609|ref|YP_008945601.1| NP_253770.1.87394 WP_003095925.1.100071 WP_003095925.1.100276 WP_003095925.1.100278 WP_003095925.1.100420 WP_003095925.1.100456 WP_003095925.1.100469 WP_003095925.1.100473 WP_003095925.1.100476 WP_003095925.1.100523 WP_003095925.1.100654 WP_003095925.1.100742 WP_003095925.1.100786 WP_003095925.1.100810 WP_003095925.1.100872 WP_003095925.1.100995 WP_003095925.1.101269 WP_003095925.1.101340 WP_003095925.1.101506 WP_003095925.1.101572 WP_003095925.1.101590 WP_003095925.1.101712 WP_003095925.1.101739 WP_003095925.1.10174 WP_003095925.1.101781 WP_003095925.1.101809 WP_003095925.1.10185 WP_003095925.1.101863 WP_003095925.1.101871 WP_003095925.1.10201 WP_003095925.1.10202 WP_003095925.1.10204 WP_003095925.1.102045 WP_003095925.1.10228 WP_003095925.1.10248 WP_003095925.1.10257 WP_003095925.1.10271 WP_003095925.1.10419 WP_003095925.1.10435 WP_003095925.1.10457 WP_003095925.1.10468 WP_003095925.1.10477 WP_003095925.1.10482 WP_003095925.1.10513 WP_003095925.1.10529 WP_003095925.1.10548 WP_003095925.1.10572 WP_003095925.1.10575 WP_003095925.1.10641 WP_003095925.1.10684 WP_003095925.1.10764 WP_003095925.1.10895 WP_003095925.1.10901 WP_003095925.1.11026 WP_003095925.1.11058 WP_003095925.1.11077 WP_003095925.1.1109 WP_003095925.1.11130 WP_003095925.1.11163 WP_003095925.1.11178 WP_003095925.1.11180 WP_003095925.1.11318 WP_003095925.1.11381 WP_003095925.1.11410 WP_003095925.1.11417 WP_003095925.1.11454 WP_003095925.1.11568 WP_003095925.1.11569 WP_003095925.1.11653 WP_003095925.1.11744 WP_003095925.1.1180 WP_003095925.1.1183 WP_003095925.1.11847 WP_003095925.1.11854 WP_003095925.1.1187 WP_003095925.1.11943 WP_003095925.1.12081 WP_003095925.1.12120 WP_003095925.1.12150 WP_003095925.1.12200 WP_003095925.1.12240 WP_003095925.1.12302 WP_003095925.1.12354 WP_003095925.1.12400 WP_003095925.1.12482 WP_003095925.1.12530 WP_003095925.1.12547 WP_003095925.1.12561 WP_003095925.1.12660 WP_003095925.1.12670 WP_003095925.1.12687 WP_003095925.1.12744 WP_003095925.1.12797 WP_003095925.1.12873 WP_003095925.1.12890 WP_003095925.1.12891 WP_003095925.1.12922 WP_003095925.1.12930 WP_003095925.1.12970 WP_003095925.1.12980 WP_003095925.1.13 WP_003095925.1.13041 WP_003095925.1.1305 WP_003095925.1.13057 WP_003095925.1.13077 WP_003095925.1.13085 WP_003095925.1.13092 WP_003095925.1.13208 WP_003095925.1.13232 WP_003095925.1.13266 WP_003095925.1.13270 WP_003095925.1.13315 WP_003095925.1.1333 WP_003095925.1.13364 WP_003095925.1.13407 WP_003095925.1.13529 WP_003095925.1.13533 WP_003095925.1.1356 WP_003095925.1.1362 WP_003095925.1.13622 WP_003095925.1.13642 WP_003095925.1.13718 WP_003095925.1.13743 WP_003095925.1.13758 WP_003095925.1.13765 WP_003095925.1.13785 WP_003095925.1.13795 WP_003095925.1.1393 WP_003095925.1.14078 WP_003095925.1.14096 WP_003095925.1.14116 WP_003095925.1.14204 WP_003095925.1.14251 WP_003095925.1.14378 WP_003095925.1.14424 WP_003095925.1.14455 WP_003095925.1.14460 WP_003095925.1.14476 WP_003095925.1.14525 WP_003095925.1.14564 WP_003095925.1.14615 WP_003095925.1.14640 WP_003095925.1.14679 WP_003095925.1.14690 WP_003095925.1.14714 WP_003095925.1.1475 WP_003095925.1.14754 WP_003095925.1.14797 WP_003095925.1.14815 WP_003095925.1.14820 WP_003095925.1.14835 WP_003095925.1.14839 WP_003095925.1.14883 WP_003095925.1.14966 WP_003095925.1.14981 WP_003095925.1.15004 WP_003095925.1.15130 WP_003095925.1.1516 WP_003095925.1.152 WP_003095925.1.15222 WP_003095925.1.15231 WP_003095925.1.15281 WP_003095925.1.15328 WP_003095925.1.15373 WP_003095925.1.15379 WP_003095925.1.15408 WP_003095925.1.15474 WP_003095925.1.15482 WP_003095925.1.15485 WP_003095925.1.15602 WP_003095925.1.15606 WP_003095925.1.15666 WP_003095925.1.15692 WP_003095925.1.15886 WP_003095925.1.15889 WP_003095925.1.15934 WP_003095925.1.16041 WP_003095925.1.16109 WP_003095925.1.16142 WP_003095925.1.16161 WP_003095925.1.16197 WP_003095925.1.162 WP_003095925.1.16267 WP_003095925.1.16279 WP_003095925.1.16694 WP_003095925.1.1670 WP_003095925.1.1671 WP_003095925.1.16751 WP_003095925.1.16782 WP_003095925.1.16788 WP_003095925.1.16801 WP_003095925.1.16808 WP_003095925.1.16811 WP_003095925.1.16895 WP_003095925.1.17022 WP_003095925.1.1704 WP_003095925.1.17108 WP_003095925.1.17155 WP_003095925.1.17162 WP_003095925.1.17177 WP_003095925.1.17189 WP_003095925.1.172 WP_003095925.1.17223 WP_003095925.1.17353 WP_003095925.1.17354 WP_003095925.1.17370 WP_003095925.1.1739 WP_003095925.1.17499 WP_003095925.1.17566 WP_003095925.1.1758 WP_003095925.1.1761 WP_003095925.1.17697 WP_003095925.1.17883 WP_003095925.1.17890 WP_003095925.1.18052 WP_003095925.1.18054 WP_003095925.1.18117 WP_003095925.1.18156 WP_003095925.1.18157 WP_003095925.1.18204 WP_003095925.1.18234 WP_003095925.1.1824 WP_003095925.1.18440 WP_003095925.1.18493 WP_003095925.1.18508 WP_003095925.1.18547 WP_003095925.1.18653 WP_003095925.1.18728 WP_003095925.1.18732 WP_003095925.1.18735 WP_003095925.1.18769 WP_003095925.1.18795 WP_003095925.1.18852 WP_003095925.1.18907 WP_003095925.1.18930 WP_003095925.1.190 WP_003095925.1.19089 WP_003095925.1.19199 WP_003095925.1.19251 WP_003095925.1.19260 WP_003095925.1.19269 WP_003095925.1.19346 WP_003095925.1.19351 WP_003095925.1.19552 WP_003095925.1.19591 WP_003095925.1.19640 WP_003095925.1.19703 WP_003095925.1.1971 WP_003095925.1.19711 WP_003095925.1.19718 WP_003095925.1.19741 WP_003095925.1.19771 WP_003095925.1.19803 WP_003095925.1.19824 WP_003095925.1.19930 WP_003095925.1.19931 WP_003095925.1.20024 WP_003095925.1.20070 WP_003095925.1.2012 WP_003095925.1.20125 WP_003095925.1.20134 WP_003095925.1.20154 WP_003095925.1.20590 WP_003095925.1.20682 WP_003095925.1.20692 WP_003095925.1.20764 WP_003095925.1.20825 WP_003095925.1.20854 WP_003095925.1.20880 WP_003095925.1.20884 WP_003095925.1.20890 WP_003095925.1.209 WP_003095925.1.20929 WP_003095925.1.20978 WP_003095925.1.21002 WP_003095925.1.21039 WP_003095925.1.21096 WP_003095925.1.21209 WP_003095925.1.21242 WP_003095925.1.21253 WP_003095925.1.21302 WP_003095925.1.21349 WP_003095925.1.21358 WP_003095925.1.21448 WP_003095925.1.21469 WP_003095925.1.21471 WP_003095925.1.21517 WP_003095925.1.21607 WP_003095925.1.21718 WP_003095925.1.2172 WP_003095925.1.21767 WP_003095925.1.21782 WP_003095925.1.21801 WP_003095925.1.21871 WP_003095925.1.21891 WP_003095925.1.21932 WP_003095925.1.22078 WP_003095925.1.221 WP_003095925.1.2228 WP_003095925.1.22316 WP_003095925.1.22324 WP_003095925.1.22365 WP_003095925.1.2237 WP_003095925.1.22389 WP_003095925.1.22390 WP_003095925.1.22394 WP_003095925.1.22442 WP_003095925.1.22477 WP_003095925.1.22491 WP_003095925.1.22573 WP_003095925.1.22704 WP_003095925.1.22729 WP_003095925.1.22863 WP_003095925.1.2289 WP_003095925.1.22891 WP_003095925.1.23013 WP_003095925.1.23166 WP_003095925.1.23191 WP_003095925.1.23195 WP_003095925.1.2323 WP_003095925.1.23264 WP_003095925.1.23331 WP_003095925.1.23418 WP_003095925.1.23421 WP_003095925.1.23512 WP_003095925.1.23518 WP_003095925.1.23523 WP_003095925.1.23525 WP_003095925.1.2355 WP_003095925.1.23559 WP_003095925.1.23581 WP_003095925.1.23611 WP_003095925.1.23641 WP_003095925.1.23715 WP_003095925.1.23739 WP_003095925.1.2374 WP_003095925.1.23769 WP_003095925.1.23782 WP_003095925.1.23794 WP_003095925.1.23884 WP_003095925.1.23925 WP_003095925.1.23938 WP_003095925.1.23961 WP_003095925.1.23967 WP_003095925.1.23983 WP_003095925.1.24066 WP_003095925.1.24077 WP_003095925.1.24087 WP_003095925.1.24101 WP_003095925.1.24183 WP_003095925.1.24234 WP_003095925.1.24319 WP_003095925.1.24351 WP_003095925.1.24382 WP_003095925.1.24413 WP_003095925.1.2453 WP_003095925.1.24626 WP_003095925.1.24662 WP_003095925.1.2477 WP_003095925.1.24851 WP_003095925.1.24879 WP_003095925.1.24938 WP_003095925.1.24940 WP_003095925.1.25033 WP_003095925.1.25052 WP_003095925.1.25075 WP_003095925.1.251 WP_003095925.1.25109 WP_003095925.1.2511 WP_003095925.1.25142 WP_003095925.1.25149 WP_003095925.1.25179 WP_003095925.1.25191 WP_003095925.1.2529 WP_003095925.1.2530 WP_003095925.1.25348 WP_003095925.1.2535 WP_003095925.1.25477 WP_003095925.1.25641 WP_003095925.1.25675 WP_003095925.1.25834 WP_003095925.1.2596 WP_003095925.1.25964 WP_003095925.1.26010 WP_003095925.1.26025 WP_003095925.1.261 WP_003095925.1.26159 WP_003095925.1.26301 WP_003095925.1.26334 WP_003095925.1.26428 WP_003095925.1.26473 WP_003095925.1.26489 WP_003095925.1.2652 WP_003095925.1.26539 WP_003095925.1.26553 WP_003095925.1.26592 WP_003095925.1.26604 WP_003095925.1.26681 WP_003095925.1.26682 WP_003095925.1.26705 WP_003095925.1.26740 WP_003095925.1.26816 WP_003095925.1.26841 WP_003095925.1.26862 WP_003095925.1.26906 WP_003095925.1.26967 WP_003095925.1.2698 WP_003095925.1.27018 WP_003095925.1.27028 WP_003095925.1.27039 WP_003095925.1.27073 WP_003095925.1.27211 WP_003095925.1.27218 WP_003095925.1.27259 WP_003095925.1.27288 WP_003095925.1.27505 WP_003095925.1.27534 WP_003095925.1.27549 WP_003095925.1.27575 WP_003095925.1.27587 WP_003095925.1.27687 WP_003095925.1.27738 WP_003095925.1.27772 WP_003095925.1.27783 WP_003095925.1.27825 WP_003095925.1.27837 WP_003095925.1.27858 WP_003095925.1.27933 WP_003095925.1.27939 WP_003095925.1.28006 WP_003095925.1.28064 WP_003095925.1.28078 WP_003095925.1.28136 WP_003095925.1.28175 WP_003095925.1.28193 WP_003095925.1.28316 WP_003095925.1.28329 WP_003095925.1.28372 WP_003095925.1.28404 WP_003095925.1.28468 WP_003095925.1.28505 WP_003095925.1.28528 WP_003095925.1.28602 WP_003095925.1.28623 WP_003095925.1.28699 WP_003095925.1.28713 WP_003095925.1.28757 WP_003095925.1.28800 WP_003095925.1.28823 WP_003095925.1.28838 WP_003095925.1.28849 WP_003095925.1.28878 WP_003095925.1.28920 WP_003095925.1.29003 WP_003095925.1.29008 WP_003095925.1.29062 WP_003095925.1.29070 WP_003095925.1.29096 WP_003095925.1.29127 WP_003095925.1.29137 WP_003095925.1.29208 WP_003095925.1.2927 WP_003095925.1.29401 WP_003095925.1.2941 WP_003095925.1.29440 WP_003095925.1.2948 WP_003095925.1.29481 WP_003095925.1.29498 WP_003095925.1.29501 WP_003095925.1.29577 WP_003095925.1.2961 WP_003095925.1.29633 WP_003095925.1.29650 WP_003095925.1.29753 WP_003095925.1.29767 WP_003095925.1.2980 WP_003095925.1.29848 WP_003095925.1.29920 WP_003095925.1.29958 WP_003095925.1.29973 WP_003095925.1.30000 WP_003095925.1.30020 WP_003095925.1.30081 WP_003095925.1.30120 WP_003095925.1.30254 WP_003095925.1.3030 WP_003095925.1.30475 WP_003095925.1.30563 WP_003095925.1.30567 WP_003095925.1.30614 WP_003095925.1.30615 WP_003095925.1.30625 WP_003095925.1.30693 WP_003095925.1.30707 WP_003095925.1.30842 WP_003095925.1.30886 WP_003095925.1.30943 WP_003095925.1.30973 WP_003095925.1.30994 WP_003095925.1.31045 WP_003095925.1.31076 WP_003095925.1.31087 WP_003095925.1.31103 WP_003095925.1.31105 WP_003095925.1.31138 WP_003095925.1.31147 WP_003095925.1.31279 WP_003095925.1.31361 WP_003095925.1.31457 WP_003095925.1.31501 WP_003095925.1.31563 WP_003095925.1.31565 WP_003095925.1.31587 WP_003095925.1.31633 WP_003095925.1.31655 WP_003095925.1.3172 WP_003095925.1.31732 WP_003095925.1.31741 WP_003095925.1.31751 WP_003095925.1.3179 WP_003095925.1.31848 WP_003095925.1.31852 WP_003095925.1.3189 WP_003095925.1.319 WP_003095925.1.31939 WP_003095925.1.32134 WP_003095925.1.32137 WP_003095925.1.32235 WP_003095925.1.32289 WP_003095925.1.32314 WP_003095925.1.32359 WP_003095925.1.32544 WP_003095925.1.32596 WP_003095925.1.32626 WP_003095925.1.32637 WP_003095925.1.32641 WP_003095925.1.32711 WP_003095925.1.32821 WP_003095925.1.32998 WP_003095925.1.33009 WP_003095925.1.33047 WP_003095925.1.33097 WP_003095925.1.33133 WP_003095925.1.33152 WP_003095925.1.33186 WP_003095925.1.33204 WP_003095925.1.33210 WP_003095925.1.33216 WP_003095925.1.33294 WP_003095925.1.33340 WP_003095925.1.33387 WP_003095925.1.33438 WP_003095925.1.33441 WP_003095925.1.33455 WP_003095925.1.33517 WP_003095925.1.33521 WP_003095925.1.33523 WP_003095925.1.33547 WP_003095925.1.33549 WP_003095925.1.33658 WP_003095925.1.33669 WP_003095925.1.3368 WP_003095925.1.33728 WP_003095925.1.33733 WP_003095925.1.3376 WP_003095925.1.33774 WP_003095925.1.33814 WP_003095925.1.33822 WP_003095925.1.33824 WP_003095925.1.33833 WP_003095925.1.3385 WP_003095925.1.33945 WP_003095925.1.34000 WP_003095925.1.34039 WP_003095925.1.34136 WP_003095925.1.34143 WP_003095925.1.34150 WP_003095925.1.34151 WP_003095925.1.34180 WP_003095925.1.34191 WP_003095925.1.34203 WP_003095925.1.34306 WP_003095925.1.34317 WP_003095925.1.3436 WP_003095925.1.34401 WP_003095925.1.34402 WP_003095925.1.34461 WP_003095925.1.34465 WP_003095925.1.34472 WP_003095925.1.3452 WP_003095925.1.34556 WP_003095925.1.34568 WP_003095925.1.34583 WP_003095925.1.34625 WP_003095925.1.34784 WP_003095925.1.34821 WP_003095925.1.34832 WP_003095925.1.34836 WP_003095925.1.34837 WP_003095925.1.34878 WP_003095925.1.34901 WP_003095925.1.35036 WP_003095925.1.35104 WP_003095925.1.35149 WP_003095925.1.35231 WP_003095925.1.35281 WP_003095925.1.3531 WP_003095925.1.35325 WP_003095925.1.35442 WP_003095925.1.35480 WP_003095925.1.35529 WP_003095925.1.3555 WP_003095925.1.35573 WP_003095925.1.35599 WP_003095925.1.35639 WP_003095925.1.35641 WP_003095925.1.35669 WP_003095925.1.35679 WP_003095925.1.35682 WP_003095925.1.3576 WP_003095925.1.35762 WP_003095925.1.35768 WP_003095925.1.35822 WP_003095925.1.35843 WP_003095925.1.35857 WP_003095925.1.35872 WP_003095925.1.35968 WP_003095925.1.35984 WP_003095925.1.36064 WP_003095925.1.36121 WP_003095925.1.36148 WP_003095925.1.36170 WP_003095925.1.36266 WP_003095925.1.36267 WP_003095925.1.36285 WP_003095925.1.36521 WP_003095925.1.36587 WP_003095925.1.36608 WP_003095925.1.36630 WP_003095925.1.36665 WP_003095925.1.36708 WP_003095925.1.3672 WP_003095925.1.36756 WP_003095925.1.36781 WP_003095925.1.36879 WP_003095925.1.37050 WP_003095925.1.37097 WP_003095925.1.37125 WP_003095925.1.37163 WP_003095925.1.37172 WP_003095925.1.37208 WP_003095925.1.3721 WP_003095925.1.37216 WP_003095925.1.373 WP_003095925.1.37319 WP_003095925.1.37366 WP_003095925.1.37416 WP_003095925.1.3742 WP_003095925.1.37500 WP_003095925.1.37512 WP_003095925.1.37571 WP_003095925.1.3768 WP_003095925.1.37698 WP_003095925.1.37703 WP_003095925.1.3773 WP_003095925.1.37799 WP_003095925.1.37814 WP_003095925.1.37818 WP_003095925.1.37826 WP_003095925.1.37842 WP_003095925.1.3785 WP_003095925.1.3792 WP_003095925.1.38003 WP_003095925.1.38023 WP_003095925.1.38060 WP_003095925.1.38087 WP_003095925.1.38102 WP_003095925.1.38146 WP_003095925.1.38151 WP_003095925.1.3818 WP_003095925.1.38186 WP_003095925.1.38319 WP_003095925.1.3833 WP_003095925.1.38335 WP_003095925.1.38337 WP_003095925.1.38430 WP_003095925.1.38450 WP_003095925.1.38502 WP_003095925.1.38505 WP_003095925.1.38510 WP_003095925.1.38582 WP_003095925.1.38583 WP_003095925.1.38587 WP_003095925.1.38657 WP_003095925.1.38661 WP_003095925.1.3870 WP_003095925.1.38706 WP_003095925.1.38816 WP_003095925.1.3887 WP_003095925.1.38889 WP_003095925.1.38932 WP_003095925.1.38971 WP_003095925.1.39046 WP_003095925.1.39088 WP_003095925.1.39186 WP_003095925.1.39271 WP_003095925.1.39345 WP_003095925.1.3943 WP_003095925.1.39444 WP_003095925.1.39452 WP_003095925.1.39458 WP_003095925.1.39537 WP_003095925.1.39704 WP_003095925.1.39765 WP_003095925.1.39786 WP_003095925.1.39920 WP_003095925.1.39949 WP_003095925.1.3998 WP_003095925.1.39989 WP_003095925.1.40059 WP_003095925.1.40115 WP_003095925.1.40135 WP_003095925.1.40207 WP_003095925.1.40213 WP_003095925.1.40237 WP_003095925.1.40243 WP_003095925.1.40271 WP_003095925.1.4038 WP_003095925.1.40419 WP_003095925.1.40442 WP_003095925.1.40512 WP_003095925.1.40541 WP_003095925.1.40546 WP_003095925.1.4058 WP_003095925.1.40874 WP_003095925.1.40950 WP_003095925.1.40984 WP_003095925.1.40993 WP_003095925.1.40994 WP_003095925.1.41110 WP_003095925.1.41137 WP_003095925.1.41199 WP_003095925.1.41290 WP_003095925.1.41291 WP_003095925.1.41301 WP_003095925.1.41384 WP_003095925.1.41412 WP_003095925.1.41429 WP_003095925.1.41487 WP_003095925.1.41502 WP_003095925.1.4156 WP_003095925.1.41618 WP_003095925.1.41625 WP_003095925.1.41692 WP_003095925.1.41703 WP_003095925.1.41725 WP_003095925.1.41732 WP_003095925.1.41748 WP_003095925.1.41773 WP_003095925.1.41832 WP_003095925.1.41846 WP_003095925.1.41871 WP_003095925.1.41888 WP_003095925.1.4190 WP_003095925.1.4196 WP_003095925.1.42 WP_003095925.1.42041 WP_003095925.1.42047 WP_003095925.1.42146 WP_003095925.1.42294 WP_003095925.1.42316 WP_003095925.1.42381 WP_003095925.1.42388 WP_003095925.1.42411 WP_003095925.1.42463 WP_003095925.1.42499 WP_003095925.1.42508 WP_003095925.1.42634 WP_003095925.1.42643 WP_003095925.1.42690 WP_003095925.1.42723 WP_003095925.1.4273 WP_003095925.1.42754 WP_003095925.1.42757 WP_003095925.1.42778 WP_003095925.1.42789 WP_003095925.1.42854 WP_003095925.1.42870 WP_003095925.1.42917 WP_003095925.1.42946 WP_003095925.1.42972 WP_003095925.1.43022 WP_003095925.1.43024 WP_003095925.1.43026 WP_003095925.1.43106 WP_003095925.1.43212 WP_003095925.1.43245 WP_003095925.1.43286 WP_003095925.1.43293 WP_003095925.1.43315 WP_003095925.1.43326 WP_003095925.1.43330 WP_003095925.1.43356 WP_003095925.1.4348 WP_003095925.1.43593 WP_003095925.1.43603 WP_003095925.1.43662 WP_003095925.1.43667 WP_003095925.1.43673 WP_003095925.1.43696 WP_003095925.1.43729 WP_003095925.1.43756 WP_003095925.1.43783 WP_003095925.1.43802 WP_003095925.1.4381 WP_003095925.1.43826 WP_003095925.1.4397 WP_003095925.1.43998 WP_003095925.1.44046 WP_003095925.1.44094 WP_003095925.1.44213 WP_003095925.1.44260 WP_003095925.1.44269 WP_003095925.1.44373 WP_003095925.1.44486 WP_003095925.1.445 WP_003095925.1.44552 WP_003095925.1.44565 WP_003095925.1.44581 WP_003095925.1.44725 WP_003095925.1.44739 WP_003095925.1.44760 WP_003095925.1.44804 WP_003095925.1.44870 WP_003095925.1.44959 WP_003095925.1.45090 WP_003095925.1.45146 WP_003095925.1.45199 WP_003095925.1.45202 WP_003095925.1.4522 WP_003095925.1.45298 WP_003095925.1.45306 WP_003095925.1.45312 WP_003095925.1.4532 WP_003095925.1.45328 WP_003095925.1.45353 WP_003095925.1.45358 WP_003095925.1.45464 WP_003095925.1.45478 WP_003095925.1.45485 WP_003095925.1.45604 WP_003095925.1.45611 WP_003095925.1.45635 WP_003095925.1.45636 WP_003095925.1.45678 WP_003095925.1.45700 WP_003095925.1.45711 WP_003095925.1.45723 WP_003095925.1.45818 WP_003095925.1.45837 WP_003095925.1.45920 WP_003095925.1.45934 WP_003095925.1.45946 WP_003095925.1.46010 WP_003095925.1.46032 WP_003095925.1.46093 WP_003095925.1.461 WP_003095925.1.46152 WP_003095925.1.46306 WP_003095925.1.4640 WP_003095925.1.46436 WP_003095925.1.46502 WP_003095925.1.46623 WP_003095925.1.46633 WP_003095925.1.46755 WP_003095925.1.46866 WP_003095925.1.46885 WP_003095925.1.46926 WP_003095925.1.46935 WP_003095925.1.4699 WP_003095925.1.47101 WP_003095925.1.47155 WP_003095925.1.47158 WP_003095925.1.4726 WP_003095925.1.47312 WP_003095925.1.47314 WP_003095925.1.47374 WP_003095925.1.47469 WP_003095925.1.47480 WP_003095925.1.47527 WP_003095925.1.47551 WP_003095925.1.47645 WP_003095925.1.47774 WP_003095925.1.47930 WP_003095925.1.47934 WP_003095925.1.47970 WP_003095925.1.48001 WP_003095925.1.48086 WP_003095925.1.48094 WP_003095925.1.48141 WP_003095925.1.48172 WP_003095925.1.48178 WP_003095925.1.48321 WP_003095925.1.48334 WP_003095925.1.4836 WP_003095925.1.48378 WP_003095925.1.48382 WP_003095925.1.48413 WP_003095925.1.48472 WP_003095925.1.48487 WP_003095925.1.48545 WP_003095925.1.48576 WP_003095925.1.48579 WP_003095925.1.48747 WP_003095925.1.48810 WP_003095925.1.48820 WP_003095925.1.48840 WP_003095925.1.48842 WP_003095925.1.48851 WP_003095925.1.48961 WP_003095925.1.49108 WP_003095925.1.4913 WP_003095925.1.49135 WP_003095925.1.49184 WP_003095925.1.49244 WP_003095925.1.49265 WP_003095925.1.49266 WP_003095925.1.49286 WP_003095925.1.49293 WP_003095925.1.49360 WP_003095925.1.49416 WP_003095925.1.49500 WP_003095925.1.49557 WP_003095925.1.49566 WP_003095925.1.49688 WP_003095925.1.49798 WP_003095925.1.49806 WP_003095925.1.49833 WP_003095925.1.49842 WP_003095925.1.49922 WP_003095925.1.49948 WP_003095925.1.49976 WP_003095925.1.49988 WP_003095925.1.49998 WP_003095925.1.50176 WP_003095925.1.50180 WP_003095925.1.50232 WP_003095925.1.50242 WP_003095925.1.5043 WP_003095925.1.50450 WP_003095925.1.50459 WP_003095925.1.50653 WP_003095925.1.50665 WP_003095925.1.50668 WP_003095925.1.50682 WP_003095925.1.50691 WP_003095925.1.50734 WP_003095925.1.50783 WP_003095925.1.50814 WP_003095925.1.50922 WP_003095925.1.50967 WP_003095925.1.50989 WP_003095925.1.51019 WP_003095925.1.51035 WP_003095925.1.51141 WP_003095925.1.51173 WP_003095925.1.51183 WP_003095925.1.51267 WP_003095925.1.51273 WP_003095925.1.51457 WP_003095925.1.51472 WP_003095925.1.51501 WP_003095925.1.51538 WP_003095925.1.51549 WP_003095925.1.51585 WP_003095925.1.51682 WP_003095925.1.51727 WP_003095925.1.51733 WP_003095925.1.51807 WP_003095925.1.51847 WP_003095925.1.51889 WP_003095925.1.51917 WP_003095925.1.51928 WP_003095925.1.51937 WP_003095925.1.51943 WP_003095925.1.51957 WP_003095925.1.51976 WP_003095925.1.52043 WP_003095925.1.52212 WP_003095925.1.52220 WP_003095925.1.52244 WP_003095925.1.5226 WP_003095925.1.52326 WP_003095925.1.52334 WP_003095925.1.5235 WP_003095925.1.52355 WP_003095925.1.52372 WP_003095925.1.52403 WP_003095925.1.52409 WP_003095925.1.52449 WP_003095925.1.52500 WP_003095925.1.52537 WP_003095925.1.5258 WP_003095925.1.52583 WP_003095925.1.52591 WP_003095925.1.5260 WP_003095925.1.52690 WP_003095925.1.52697 WP_003095925.1.52700 WP_003095925.1.52728 WP_003095925.1.52784 WP_003095925.1.52790 WP_003095925.1.52850 WP_003095925.1.5289 WP_003095925.1.52939 WP_003095925.1.5294 WP_003095925.1.53037 WP_003095925.1.53038 WP_003095925.1.53070 WP_003095925.1.53072 WP_003095925.1.53267 WP_003095925.1.53287 WP_003095925.1.53351 WP_003095925.1.53371 WP_003095925.1.53414 WP_003095925.1.53427 WP_003095925.1.53486 WP_003095925.1.53528 WP_003095925.1.53530 WP_003095925.1.53586 WP_003095925.1.53663 WP_003095925.1.53678 WP_003095925.1.53719 WP_003095925.1.53726 WP_003095925.1.5388 WP_003095925.1.53932 WP_003095925.1.53946 WP_003095925.1.53948 WP_003095925.1.53951 WP_003095925.1.5399 WP_003095925.1.54003 WP_003095925.1.54076 WP_003095925.1.54090 WP_003095925.1.54133 WP_003095925.1.54140 WP_003095925.1.54146 WP_003095925.1.5420 WP_003095925.1.54248 WP_003095925.1.54293 WP_003095925.1.54354 WP_003095925.1.54462 WP_003095925.1.54571 WP_003095925.1.54742 WP_003095925.1.54809 WP_003095925.1.54974 WP_003095925.1.55 WP_003095925.1.55089 WP_003095925.1.55169 WP_003095925.1.55347 WP_003095925.1.55387 WP_003095925.1.55400 WP_003095925.1.55445 WP_003095925.1.55813 WP_003095925.1.55976 WP_003095925.1.56013 WP_003095925.1.56037 WP_003095925.1.56145 WP_003095925.1.56187 WP_003095925.1.56196 WP_003095925.1.56229 WP_003095925.1.56315 WP_003095925.1.56348 WP_003095925.1.56442 WP_003095925.1.56452 WP_003095925.1.56465 WP_003095925.1.56475 WP_003095925.1.56623 WP_003095925.1.56626 WP_003095925.1.56632 WP_003095925.1.56745 WP_003095925.1.56768 WP_003095925.1.56797 WP_003095925.1.56819 WP_003095925.1.56837 WP_003095925.1.56864 WP_003095925.1.56896 WP_003095925.1.56973 WP_003095925.1.57005 WP_003095925.1.57020 WP_003095925.1.57065 WP_003095925.1.57113 WP_003095925.1.57131 WP_003095925.1.57276 WP_003095925.1.5731 WP_003095925.1.57339 WP_003095925.1.57369 WP_003095925.1.57417 WP_003095925.1.57477 WP_003095925.1.57480 WP_003095925.1.57532 WP_003095925.1.57566 WP_003095925.1.57728 WP_003095925.1.57792 WP_003095925.1.57841 WP_003095925.1.57853 WP_003095925.1.57921 WP_003095925.1.57966 WP_003095925.1.58183 WP_003095925.1.58193 WP_003095925.1.58200 WP_003095925.1.58228 WP_003095925.1.58360 WP_003095925.1.58417 WP_003095925.1.58436 WP_003095925.1.58482 WP_003095925.1.5850 WP_003095925.1.58510 WP_003095925.1.58527 WP_003095925.1.5856 WP_003095925.1.58581 WP_003095925.1.58689 WP_003095925.1.5869 WP_003095925.1.58800 WP_003095925.1.58838 WP_003095925.1.58845 WP_003095925.1.5889 WP_003095925.1.58944 WP_003095925.1.58952 WP_003095925.1.5897 WP_003095925.1.59013 WP_003095925.1.59076 WP_003095925.1.59099 WP_003095925.1.59123 WP_003095925.1.59156 WP_003095925.1.59158 WP_003095925.1.59176 WP_003095925.1.59212 WP_003095925.1.59249 WP_003095925.1.59250 WP_003095925.1.59288 WP_003095925.1.59339 WP_003095925.1.59376 WP_003095925.1.59385 WP_003095925.1.59563 WP_003095925.1.59724 WP_003095925.1.59797 WP_003095925.1.59831 WP_003095925.1.59870 WP_003095925.1.59943 WP_003095925.1.60051 WP_003095925.1.60062 WP_003095925.1.60079 WP_003095925.1.60084 WP_003095925.1.60206 WP_003095925.1.60261 WP_003095925.1.60347 WP_003095925.1.60364 WP_003095925.1.60396 WP_003095925.1.60415 WP_003095925.1.60467 WP_003095925.1.60472 WP_003095925.1.60509 WP_003095925.1.60600 WP_003095925.1.60602 WP_003095925.1.60603 WP_003095925.1.60639 WP_003095925.1.60679 WP_003095925.1.60686 WP_003095925.1.607 WP_003095925.1.60850 WP_003095925.1.60916 WP_003095925.1.60970 WP_003095925.1.61122 WP_003095925.1.61130 WP_003095925.1.61222 WP_003095925.1.61269 WP_003095925.1.61288 WP_003095925.1.61294 WP_003095925.1.6130 WP_003095925.1.61431 WP_003095925.1.61493 WP_003095925.1.61549 WP_003095925.1.61598 WP_003095925.1.616 WP_003095925.1.61696 WP_003095925.1.6173 WP_003095925.1.61943 WP_003095925.1.62035 WP_003095925.1.62186 WP_003095925.1.62211 WP_003095925.1.62263 WP_003095925.1.62357 WP_003095925.1.62410 WP_003095925.1.6242 WP_003095925.1.62483 WP_003095925.1.62516 WP_003095925.1.62534 WP_003095925.1.626 WP_003095925.1.62604 WP_003095925.1.62635 WP_003095925.1.62688 WP_003095925.1.62701 WP_003095925.1.62703 WP_003095925.1.62704 WP_003095925.1.62708 WP_003095925.1.62716 WP_003095925.1.62768 WP_003095925.1.62772 WP_003095925.1.6283 WP_003095925.1.62834 WP_003095925.1.62838 WP_003095925.1.62873 WP_003095925.1.62917 WP_003095925.1.62961 WP_003095925.1.62977 WP_003095925.1.63038 WP_003095925.1.63041 WP_003095925.1.63124 WP_003095925.1.63193 WP_003095925.1.63196 WP_003095925.1.63338 WP_003095925.1.63401 WP_003095925.1.63591 WP_003095925.1.63597 WP_003095925.1.63659 WP_003095925.1.63739 WP_003095925.1.63784 WP_003095925.1.63929 WP_003095925.1.63941 WP_003095925.1.64139 WP_003095925.1.64155 WP_003095925.1.64212 WP_003095925.1.64329 WP_003095925.1.64340 WP_003095925.1.6450 WP_003095925.1.64544 WP_003095925.1.64603 WP_003095925.1.64605 WP_003095925.1.6461 WP_003095925.1.64611 WP_003095925.1.64726 WP_003095925.1.64748 WP_003095925.1.64799 WP_003095925.1.64807 WP_003095925.1.64854 WP_003095925.1.64862 WP_003095925.1.64880 WP_003095925.1.64885 WP_003095925.1.64886 WP_003095925.1.64983 WP_003095925.1.64984 WP_003095925.1.65009 WP_003095925.1.65066 WP_003095925.1.65095 WP_003095925.1.65099 WP_003095925.1.65145 WP_003095925.1.65196 WP_003095925.1.65227 WP_003095925.1.65247 WP_003095925.1.65285 WP_003095925.1.65304 WP_003095925.1.65312 WP_003095925.1.65316 WP_003095925.1.65334 WP_003095925.1.65335 WP_003095925.1.65337 WP_003095925.1.65457 WP_003095925.1.65478 WP_003095925.1.65549 WP_003095925.1.65632 WP_003095925.1.65642 WP_003095925.1.65679 WP_003095925.1.65779 WP_003095925.1.65819 WP_003095925.1.65867 WP_003095925.1.6589 WP_003095925.1.65926 WP_003095925.1.66088 WP_003095925.1.66155 WP_003095925.1.66165 WP_003095925.1.6627 WP_003095925.1.66277 WP_003095925.1.6629 WP_003095925.1.66348 WP_003095925.1.66364 WP_003095925.1.66371 WP_003095925.1.66526 WP_003095925.1.66563 WP_003095925.1.66693 WP_003095925.1.66721 WP_003095925.1.66892 WP_003095925.1.66929 WP_003095925.1.66931 WP_003095925.1.66945 WP_003095925.1.66950 WP_003095925.1.66982 WP_003095925.1.67188 WP_003095925.1.67192 WP_003095925.1.67205 WP_003095925.1.67261 WP_003095925.1.67269 WP_003095925.1.67370 WP_003095925.1.67388 WP_003095925.1.67472 WP_003095925.1.67489 WP_003095925.1.67506 WP_003095925.1.67526 WP_003095925.1.67531 WP_003095925.1.67545 WP_003095925.1.6768 WP_003095925.1.67686 WP_003095925.1.67755 WP_003095925.1.67830 WP_003095925.1.67874 WP_003095925.1.67875 WP_003095925.1.67937 WP_003095925.1.67948 WP_003095925.1.6796 WP_003095925.1.68000 WP_003095925.1.68172 WP_003095925.1.68183 WP_003095925.1.68194 WP_003095925.1.68252 WP_003095925.1.68317 WP_003095925.1.68446 WP_003095925.1.68448 WP_003095925.1.68472 WP_003095925.1.68499 WP_003095925.1.6850 WP_003095925.1.68541 WP_003095925.1.68568 WP_003095925.1.68638 WP_003095925.1.68756 WP_003095925.1.68781 WP_003095925.1.68790 WP_003095925.1.68800 WP_003095925.1.68802 WP_003095925.1.68850 WP_003095925.1.68857 WP_003095925.1.68862 WP_003095925.1.68881 WP_003095925.1.68910 WP_003095925.1.68938 WP_003095925.1.68979 WP_003095925.1.69088 WP_003095925.1.6911 WP_003095925.1.69159 WP_003095925.1.69209 WP_003095925.1.69260 WP_003095925.1.6928 WP_003095925.1.6937 WP_003095925.1.69411 WP_003095925.1.69534 WP_003095925.1.69599 WP_003095925.1.69702 WP_003095925.1.69819 WP_003095925.1.69834 WP_003095925.1.69907 WP_003095925.1.69993 WP_003095925.1.70092 WP_003095925.1.70098 WP_003095925.1.70138 WP_003095925.1.70168 WP_003095925.1.70194 WP_003095925.1.70229 WP_003095925.1.70331 WP_003095925.1.70460 WP_003095925.1.70470 WP_003095925.1.70537 WP_003095925.1.70561 WP_003095925.1.70583 WP_003095925.1.70648 WP_003095925.1.70650 WP_003095925.1.70677 WP_003095925.1.70693 WP_003095925.1.7077 WP_003095925.1.70778 WP_003095925.1.70991 WP_003095925.1.71038 WP_003095925.1.71141 WP_003095925.1.71203 WP_003095925.1.71234 WP_003095925.1.71249 WP_003095925.1.71254 WP_003095925.1.7128 WP_003095925.1.71290 WP_003095925.1.71346 WP_003095925.1.71385 WP_003095925.1.71412 WP_003095925.1.71570 WP_003095925.1.71610 WP_003095925.1.7163 WP_003095925.1.71642 WP_003095925.1.71666 WP_003095925.1.71738 WP_003095925.1.71799 WP_003095925.1.71806 WP_003095925.1.71822 WP_003095925.1.71862 WP_003095925.1.71866 WP_003095925.1.71891 WP_003095925.1.71927 WP_003095925.1.72167 WP_003095925.1.72181 WP_003095925.1.72183 WP_003095925.1.7219 WP_003095925.1.72287 WP_003095925.1.72323 WP_003095925.1.72331 WP_003095925.1.72346 WP_003095925.1.72458 WP_003095925.1.72477 WP_003095925.1.72541 WP_003095925.1.72570 WP_003095925.1.72662 WP_003095925.1.72727 WP_003095925.1.7276 WP_003095925.1.72768 WP_003095925.1.72772 WP_003095925.1.72782 WP_003095925.1.72845 WP_003095925.1.72920 WP_003095925.1.73035 WP_003095925.1.73048 WP_003095925.1.7308 WP_003095925.1.73135 WP_003095925.1.73149 WP_003095925.1.73172 WP_003095925.1.73192 WP_003095925.1.7327 WP_003095925.1.733 WP_003095925.1.73455 WP_003095925.1.73490 WP_003095925.1.73523 WP_003095925.1.73541 WP_003095925.1.73601 WP_003095925.1.73651 WP_003095925.1.73719 WP_003095925.1.7377 WP_003095925.1.73791 WP_003095925.1.7382 WP_003095925.1.73860 WP_003095925.1.73911 WP_003095925.1.73941 WP_003095925.1.74 WP_003095925.1.74000 WP_003095925.1.74072 WP_003095925.1.74074 WP_003095925.1.74106 WP_003095925.1.74167 WP_003095925.1.74175 WP_003095925.1.74182 WP_003095925.1.74219 WP_003095925.1.74264 WP_003095925.1.74281 WP_003095925.1.74287 WP_003095925.1.74326 WP_003095925.1.7445 WP_003095925.1.74458 WP_003095925.1.74473 WP_003095925.1.74475 WP_003095925.1.7448 WP_003095925.1.74518 WP_003095925.1.7456 WP_003095925.1.74568 WP_003095925.1.74604 WP_003095925.1.74629 WP_003095925.1.74637 WP_003095925.1.74685 WP_003095925.1.74776 WP_003095925.1.748 WP_003095925.1.74878 WP_003095925.1.74941 WP_003095925.1.74958 WP_003095925.1.7501 WP_003095925.1.75041 WP_003095925.1.75119 WP_003095925.1.75204 WP_003095925.1.75277 WP_003095925.1.75303 WP_003095925.1.75389 WP_003095925.1.75431 WP_003095925.1.7547 WP_003095925.1.75549 WP_003095925.1.75573 WP_003095925.1.75580 WP_003095925.1.75599 WP_003095925.1.75603 WP_003095925.1.75631 WP_003095925.1.7568 WP_003095925.1.75756 WP_003095925.1.75771 WP_003095925.1.75792 WP_003095925.1.75825 WP_003095925.1.75826 WP_003095925.1.75935 WP_003095925.1.75938 WP_003095925.1.75947 WP_003095925.1.7595 WP_003095925.1.76077 WP_003095925.1.76092 WP_003095925.1.76141 WP_003095925.1.76145 WP_003095925.1.76192 WP_003095925.1.76322 WP_003095925.1.76355 WP_003095925.1.76383 WP_003095925.1.76399 WP_003095925.1.76441 WP_003095925.1.76467 WP_003095925.1.76484 WP_003095925.1.76543 WP_003095925.1.76600 WP_003095925.1.76633 WP_003095925.1.76716 WP_003095925.1.76775 WP_003095925.1.76791 WP_003095925.1.76861 WP_003095925.1.76985 WP_003095925.1.77235 WP_003095925.1.77238 WP_003095925.1.77286 WP_003095925.1.77317 WP_003095925.1.77442 WP_003095925.1.77476 WP_003095925.1.77574 WP_003095925.1.77686 WP_003095925.1.77750 WP_003095925.1.77769 WP_003095925.1.7779 WP_003095925.1.77819 WP_003095925.1.77834 WP_003095925.1.77913 WP_003095925.1.78104 WP_003095925.1.78112 WP_003095925.1.78118 WP_003095925.1.78134 WP_003095925.1.78148 WP_003095925.1.78280 WP_003095925.1.78288 WP_003095925.1.78380 WP_003095925.1.7840 WP_003095925.1.78425 WP_003095925.1.78430 WP_003095925.1.78437 WP_003095925.1.78570 WP_003095925.1.78599 WP_003095925.1.78623 WP_003095925.1.78693 WP_003095925.1.78795 WP_003095925.1.788 WP_003095925.1.78810 WP_003095925.1.78947 WP_003095925.1.78954 WP_003095925.1.78986 WP_003095925.1.7899 WP_003095925.1.79003 WP_003095925.1.79007 WP_003095925.1.79053 WP_003095925.1.79060 WP_003095925.1.79177 WP_003095925.1.79256 WP_003095925.1.79279 WP_003095925.1.79286 WP_003095925.1.79311 WP_003095925.1.79421 WP_003095925.1.79431 WP_003095925.1.79463 WP_003095925.1.7953 WP_003095925.1.79569 WP_003095925.1.79631 WP_003095925.1.79699 WP_003095925.1.79754 WP_003095925.1.79788 WP_003095925.1.79862 WP_003095925.1.79883 WP_003095925.1.799 WP_003095925.1.79902 WP_003095925.1.79908 WP_003095925.1.79986 WP_003095925.1.8 WP_003095925.1.80033 WP_003095925.1.80068 WP_003095925.1.80087 WP_003095925.1.80102 WP_003095925.1.8013 WP_003095925.1.80174 WP_003095925.1.80258 WP_003095925.1.8028 WP_003095925.1.80306 WP_003095925.1.8038 WP_003095925.1.80410 WP_003095925.1.80411 WP_003095925.1.80454 WP_003095925.1.80481 WP_003095925.1.8051 WP_003095925.1.80535 WP_003095925.1.80572 WP_003095925.1.80627 WP_003095925.1.80632 WP_003095925.1.8064 WP_003095925.1.80645 WP_003095925.1.80683 WP_003095925.1.80715 WP_003095925.1.80720 WP_003095925.1.80785 WP_003095925.1.80846 WP_003095925.1.80880 WP_003095925.1.80892 WP_003095925.1.80910 WP_003095925.1.80926 WP_003095925.1.80931 WP_003095925.1.80938 WP_003095925.1.80969 WP_003095925.1.81081 WP_003095925.1.81082 WP_003095925.1.8110 WP_003095925.1.81206 WP_003095925.1.81237 WP_003095925.1.81331 WP_003095925.1.81338 WP_003095925.1.81349 WP_003095925.1.81368 WP_003095925.1.81380 WP_003095925.1.8141 WP_003095925.1.81426 WP_003095925.1.81470 WP_003095925.1.81487 WP_003095925.1.81581 WP_003095925.1.81591 WP_003095925.1.81622 WP_003095925.1.81643 WP_003095925.1.81708 WP_003095925.1.81742 WP_003095925.1.81771 WP_003095925.1.81784 WP_003095925.1.81802 WP_003095925.1.81816 WP_003095925.1.81834 WP_003095925.1.81844 WP_003095925.1.81856 WP_003095925.1.81874 WP_003095925.1.81927 WP_003095925.1.81950 WP_003095925.1.81957 WP_003095925.1.81960 WP_003095925.1.82117 WP_003095925.1.82127 WP_003095925.1.82260 WP_003095925.1.82310 WP_003095925.1.82312 WP_003095925.1.82328 WP_003095925.1.82334 WP_003095925.1.8238 WP_003095925.1.82604 WP_003095925.1.82620 WP_003095925.1.82643 WP_003095925.1.82686 WP_003095925.1.82710 WP_003095925.1.82798 WP_003095925.1.82810 WP_003095925.1.8284 WP_003095925.1.82882 WP_003095925.1.83131 WP_003095925.1.83184 WP_003095925.1.83213 WP_003095925.1.83251 WP_003095925.1.83267 WP_003095925.1.83296 WP_003095925.1.83317 WP_003095925.1.83374 WP_003095925.1.83394 WP_003095925.1.83440 WP_003095925.1.83460 WP_003095925.1.835 WP_003095925.1.83503 WP_003095925.1.8351 WP_003095925.1.8353 WP_003095925.1.83534 WP_003095925.1.83540 WP_003095925.1.8357 WP_003095925.1.83673 WP_003095925.1.83698 WP_003095925.1.83871 WP_003095925.1.83937 WP_003095925.1.83946 WP_003095925.1.84003 WP_003095925.1.84008 WP_003095925.1.84138 WP_003095925.1.84174 WP_003095925.1.84178 WP_003095925.1.84190 WP_003095925.1.84203 WP_003095925.1.84271 WP_003095925.1.84297 WP_003095925.1.84374 WP_003095925.1.84398 WP_003095925.1.84439 WP_003095925.1.84471 WP_003095925.1.84487 WP_003095925.1.84526 WP_003095925.1.8453 WP_003095925.1.84538 WP_003095925.1.84558 WP_003095925.1.84589 WP_003095925.1.84674 WP_003095925.1.84684 WP_003095925.1.84702 WP_003095925.1.84715 WP_003095925.1.84754 WP_003095925.1.84792 WP_003095925.1.84825 WP_003095925.1.8484 WP_003095925.1.84937 WP_003095925.1.84946 WP_003095925.1.8498 WP_003095925.1.85018 WP_003095925.1.85028 WP_003095925.1.85059 WP_003095925.1.85150 WP_003095925.1.85290 WP_003095925.1.85311 WP_003095925.1.85318 WP_003095925.1.85453 WP_003095925.1.85574 WP_003095925.1.85633 WP_003095925.1.85638 WP_003095925.1.85788 WP_003095925.1.85897 WP_003095925.1.85910 WP_003095925.1.85978 WP_003095925.1.86002 WP_003095925.1.86047 WP_003095925.1.86058 WP_003095925.1.86182 WP_003095925.1.86243 WP_003095925.1.86278 WP_003095925.1.86287 WP_003095925.1.86293 WP_003095925.1.86386 WP_003095925.1.86432 WP_003095925.1.8645 WP_003095925.1.865 WP_003095925.1.86506 WP_003095925.1.86545 WP_003095925.1.86552 WP_003095925.1.86554 WP_003095925.1.86595 WP_003095925.1.86652 WP_003095925.1.86665 WP_003095925.1.867 WP_003095925.1.86708 WP_003095925.1.86733 WP_003095925.1.86785 WP_003095925.1.86796 WP_003095925.1.86813 WP_003095925.1.86822 WP_003095925.1.86947 WP_003095925.1.86970 WP_003095925.1.86985 WP_003095925.1.87104 WP_003095925.1.87163 WP_003095925.1.8718 WP_003095925.1.8727 WP_003095925.1.87316 WP_003095925.1.87390 WP_003095925.1.87435 WP_003095925.1.87463 WP_003095925.1.8749 WP_003095925.1.87530 WP_003095925.1.87547 WP_003095925.1.87648 WP_003095925.1.87763 WP_003095925.1.8777 WP_003095925.1.8785 WP_003095925.1.87877 WP_003095925.1.87888 WP_003095925.1.87970 WP_003095925.1.87975 WP_003095925.1.87981 WP_003095925.1.87987 WP_003095925.1.88004 WP_003095925.1.88330 WP_003095925.1.88415 WP_003095925.1.88540 WP_003095925.1.88550 WP_003095925.1.88605 WP_003095925.1.88659 WP_003095925.1.88679 WP_003095925.1.88680 WP_003095925.1.88714 WP_003095925.1.88750 WP_003095925.1.88796 WP_003095925.1.889 WP_003095925.1.88900 WP_003095925.1.88949 WP_003095925.1.89098 WP_003095925.1.8911 WP_003095925.1.89234 WP_003095925.1.89245 WP_003095925.1.89266 WP_003095925.1.89276 WP_003095925.1.89330 WP_003095925.1.89409 WP_003095925.1.89434 WP_003095925.1.89440 WP_003095925.1.89480 WP_003095925.1.8949 WP_003095925.1.89491 WP_003095925.1.89523 WP_003095925.1.89577 WP_003095925.1.89610 WP_003095925.1.89662 WP_003095925.1.89669 WP_003095925.1.89736 WP_003095925.1.8976 WP_003095925.1.89805 WP_003095925.1.89866 WP_003095925.1.89867 WP_003095925.1.89868 WP_003095925.1.89871 WP_003095925.1.89886 WP_003095925.1.89992 WP_003095925.1.90024 WP_003095925.1.90056 WP_003095925.1.90189 WP_003095925.1.90224 WP_003095925.1.90242 WP_003095925.1.90272 WP_003095925.1.90306 WP_003095925.1.90412 WP_003095925.1.9056 WP_003095925.1.90569 WP_003095925.1.90655 WP_003095925.1.90770 WP_003095925.1.90940 WP_003095925.1.91012 WP_003095925.1.91093 WP_003095925.1.91161 WP_003095925.1.9120 WP_003095925.1.91204 WP_003095925.1.91236 WP_003095925.1.91281 WP_003095925.1.91307 WP_003095925.1.91360 WP_003095925.1.91392 WP_003095925.1.91416 WP_003095925.1.9143 WP_003095925.1.91431 WP_003095925.1.91467 WP_003095925.1.91527 WP_003095925.1.91563 WP_003095925.1.91585 WP_003095925.1.91796 WP_003095925.1.91803 WP_003095925.1.9182 WP_003095925.1.91846 WP_003095925.1.91860 WP_003095925.1.91862 WP_003095925.1.91882 WP_003095925.1.9191 WP_003095925.1.91943 WP_003095925.1.92043 WP_003095925.1.92175 WP_003095925.1.9219 WP_003095925.1.92314 WP_003095925.1.92321 WP_003095925.1.92357 WP_003095925.1.92454 WP_003095925.1.92573 WP_003095925.1.92585 WP_003095925.1.92587 WP_003095925.1.92589 WP_003095925.1.92594 WP_003095925.1.92624 WP_003095925.1.92630 WP_003095925.1.9272 WP_003095925.1.92759 WP_003095925.1.92769 WP_003095925.1.92839 WP_003095925.1.92894 WP_003095925.1.93001 WP_003095925.1.93122 WP_003095925.1.93130 WP_003095925.1.93144 WP_003095925.1.93148 WP_003095925.1.93196 WP_003095925.1.93250 WP_003095925.1.93264 WP_003095925.1.9328 WP_003095925.1.93446 WP_003095925.1.9349 WP_003095925.1.93493 WP_003095925.1.93520 WP_003095925.1.93568 WP_003095925.1.93797 WP_003095925.1.93848 WP_003095925.1.93889 WP_003095925.1.93897 WP_003095925.1.94004 WP_003095925.1.94031 WP_003095925.1.94065 WP_003095925.1.94078 WP_003095925.1.94174 WP_003095925.1.94218 WP_003095925.1.94230 WP_003095925.1.94243 WP_003095925.1.94285 WP_003095925.1.94288 WP_003095925.1.94333 WP_003095925.1.94349 WP_003095925.1.94385 WP_003095925.1.94422 WP_003095925.1.94434 WP_003095925.1.9444 WP_003095925.1.94450 WP_003095925.1.94682 WP_003095925.1.94732 WP_003095925.1.94742 WP_003095925.1.94814 WP_003095925.1.94818 WP_003095925.1.94856 WP_003095925.1.94881 WP_003095925.1.94896 WP_003095925.1.94897 WP_003095925.1.94943 WP_003095925.1.95018 WP_003095925.1.95027 WP_003095925.1.95056 WP_003095925.1.95117 WP_003095925.1.95132 WP_003095925.1.95187 WP_003095925.1.95207 WP_003095925.1.95217 WP_003095925.1.95305 WP_003095925.1.95324 WP_003095925.1.95354 WP_003095925.1.95460 WP_003095925.1.95525 WP_003095925.1.95536 WP_003095925.1.95668 WP_003095925.1.95745 WP_003095925.1.95751 WP_003095925.1.95774 WP_003095925.1.95782 WP_003095925.1.95802 WP_003095925.1.95820 WP_003095925.1.95825 WP_003095925.1.95959 WP_003095925.1.9599 WP_003095925.1.95999 WP_003095925.1.96008 WP_003095925.1.9604 WP_003095925.1.96041 WP_003095925.1.96058 WP_003095925.1.961 WP_003095925.1.96193 WP_003095925.1.96243 WP_003095925.1.96267 WP_003095925.1.96357 WP_003095925.1.96434 WP_003095925.1.96506 WP_003095925.1.96667 WP_003095925.1.96863 WP_003095925.1.96880 WP_003095925.1.96967 WP_003095925.1.9706 WP_003095925.1.97118 WP_003095925.1.97126 WP_003095925.1.97204 WP_003095925.1.97213 WP_003095925.1.9722 WP_003095925.1.97271 WP_003095925.1.97272 WP_003095925.1.97377 WP_003095925.1.97461 WP_003095925.1.97474 WP_003095925.1.97488 WP_003095925.1.97499 WP_003095925.1.97503 WP_003095925.1.97521 WP_003095925.1.97583 WP_003095925.1.97614 WP_003095925.1.97784 WP_003095925.1.97826 WP_003095925.1.97877 WP_003095925.1.97968 WP_003095925.1.98111 WP_003095925.1.98276 WP_003095925.1.98308 WP_003095925.1.98410 WP_003095925.1.98414 WP_003095925.1.98433 WP_003095925.1.9845 WP_003095925.1.985 WP_003095925.1.98522 WP_003095925.1.98573 WP_003095925.1.98600 WP_003095925.1.98610 WP_003095925.1.98672 WP_003095925.1.98678 WP_003095925.1.98693 WP_003095925.1.98718 WP_003095925.1.98788 WP_003095925.1.98873 WP_003095925.1.98907 WP_003095925.1.98926 WP_003095925.1.98963 WP_003095925.1.99065 WP_003095925.1.99068 WP_003095925.1.99103 WP_003095925.1.99214 WP_003095925.1.99293 WP_003095925.1.99353 WP_003095925.1.99378 WP_003095925.1.99386 WP_003095925.1.99443 WP_003095925.1.99461 WP_003095925.1.9951 WP_003095925.1.99647 WP_003095925.1.99654 WP_003095925.1.99662 WP_003095925.1.99746 WP_003095925.1.99757 WP_003095925.1.99772 WP_003095925.1.99795 WP_003095925.1.99835 WP_003095925.1.9989 WP_003095925.1.99930 gi|15600276|ref|NP_253770.1| gi|558675271|ref|YP_008811979.1| gi|218894182|ref|YP_002443051.1| gi|478481532|ref|YP_007712183.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]