SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|568156833|ref|YP_008945826.1| from Pseudomonas aeruginosa LES431

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|568156833|ref|YP_008945826.1|
Domain Number 1 Region: 9-117
Classification Level Classification E-value
Superfamily YjgF-like 5.97e-33
Family YjgF/L-PSP 0.0011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|568156833|ref|YP_008945826.1|
Sequence length 117
Comment cytochrome C2 [Pseudomonas aeruginosa LES431]
Sequence
MPIQRQHTNERMSQIVVHNGTVYLAGQVGEDMSAGVEQQTRETLAAIERLLEEAGTDKTR
ILSVTIYLKDIDADFEGMNRVWDQWLPRGVAPARATVEAKLCEPEILVEMSVVAALP
Download sequence
Identical sequences A0A071LDI0 A0A086BUA8 A0A0E1B6M7 A0A0H2ZJD3 A0A0H3QPK7 A0A157YZP6 A0A1C7BC79 A0A1E9C102 A0A1F0I370 A0A1G5LFG2 A6VEA8 Q9HTQ1 W1MVN2
gi|564955697|ref|YP_008888267.1| NP_253990.1.87394 WP_003098273.1.100071 WP_003098273.1.100100 WP_003098273.1.100179 WP_003098273.1.100276 WP_003098273.1.100278 WP_003098273.1.100394 WP_003098273.1.100420 WP_003098273.1.100456 WP_003098273.1.100473 WP_003098273.1.100476 WP_003098273.1.100523 WP_003098273.1.100654 WP_003098273.1.100723 WP_003098273.1.100742 WP_003098273.1.100777 WP_003098273.1.100786 WP_003098273.1.100808 WP_003098273.1.100809 WP_003098273.1.100810 WP_003098273.1.100872 WP_003098273.1.100983 WP_003098273.1.100995 WP_003098273.1.101021 WP_003098273.1.101090 WP_003098273.1.101269 WP_003098273.1.101340 WP_003098273.1.101506 WP_003098273.1.101572 WP_003098273.1.101642 WP_003098273.1.101712 WP_003098273.1.101739 WP_003098273.1.101819 WP_003098273.1.10185 WP_003098273.1.101863 WP_003098273.1.101871 WP_003098273.1.10201 WP_003098273.1.10202 WP_003098273.1.10204 WP_003098273.1.102045 WP_003098273.1.10228 WP_003098273.1.10248 WP_003098273.1.10257 WP_003098273.1.1037 WP_003098273.1.10407 WP_003098273.1.10419 WP_003098273.1.10435 WP_003098273.1.10457 WP_003098273.1.10468 WP_003098273.1.10477 WP_003098273.1.10513 WP_003098273.1.10529 WP_003098273.1.10548 WP_003098273.1.10572 WP_003098273.1.10575 WP_003098273.1.10636 WP_003098273.1.10641 WP_003098273.1.10764 WP_003098273.1.10856 WP_003098273.1.10895 WP_003098273.1.10901 WP_003098273.1.10949 WP_003098273.1.11026 WP_003098273.1.11058 WP_003098273.1.1107 WP_003098273.1.11077 WP_003098273.1.1109 WP_003098273.1.11163 WP_003098273.1.11178 WP_003098273.1.11318 WP_003098273.1.11381 WP_003098273.1.11388 WP_003098273.1.11417 WP_003098273.1.11454 WP_003098273.1.11568 WP_003098273.1.11569 WP_003098273.1.11653 WP_003098273.1.11744 WP_003098273.1.11754 WP_003098273.1.1180 WP_003098273.1.11847 WP_003098273.1.11854 WP_003098273.1.1187 WP_003098273.1.11943 WP_003098273.1.12018 WP_003098273.1.12081 WP_003098273.1.12120 WP_003098273.1.12150 WP_003098273.1.12200 WP_003098273.1.12208 WP_003098273.1.12240 WP_003098273.1.12302 WP_003098273.1.12354 WP_003098273.1.1238 WP_003098273.1.12400 WP_003098273.1.12482 WP_003098273.1.12497 WP_003098273.1.12530 WP_003098273.1.12547 WP_003098273.1.12561 WP_003098273.1.12657 WP_003098273.1.12687 WP_003098273.1.12744 WP_003098273.1.12797 WP_003098273.1.12838 WP_003098273.1.12873 WP_003098273.1.12891 WP_003098273.1.12922 WP_003098273.1.12930 WP_003098273.1.12934 WP_003098273.1.12970 WP_003098273.1.12980 WP_003098273.1.13 WP_003098273.1.13041 WP_003098273.1.1305 WP_003098273.1.13057 WP_003098273.1.13085 WP_003098273.1.13092 WP_003098273.1.13208 WP_003098273.1.13232 WP_003098273.1.13242 WP_003098273.1.13266 WP_003098273.1.13270 WP_003098273.1.13315 WP_003098273.1.1333 WP_003098273.1.13407 WP_003098273.1.13529 WP_003098273.1.13533 WP_003098273.1.1356 WP_003098273.1.1362 WP_003098273.1.13622 WP_003098273.1.13718 WP_003098273.1.13743 WP_003098273.1.13758 WP_003098273.1.13765 WP_003098273.1.13785 WP_003098273.1.13795 WP_003098273.1.13828 WP_003098273.1.13865 WP_003098273.1.1393 WP_003098273.1.14049 WP_003098273.1.14078 WP_003098273.1.14096 WP_003098273.1.14251 WP_003098273.1.14345 WP_003098273.1.14378 WP_003098273.1.14424 WP_003098273.1.14460 WP_003098273.1.14463 WP_003098273.1.14476 WP_003098273.1.14525 WP_003098273.1.14564 WP_003098273.1.14615 WP_003098273.1.14640 WP_003098273.1.14714 WP_003098273.1.1475 WP_003098273.1.14754 WP_003098273.1.14815 WP_003098273.1.14820 WP_003098273.1.14883 WP_003098273.1.14966 WP_003098273.1.14981 WP_003098273.1.15004 WP_003098273.1.15130 WP_003098273.1.1516 WP_003098273.1.152 WP_003098273.1.15222 WP_003098273.1.15231 WP_003098273.1.15281 WP_003098273.1.15297 WP_003098273.1.15328 WP_003098273.1.15373 WP_003098273.1.15379 WP_003098273.1.15474 WP_003098273.1.15480 WP_003098273.1.15485 WP_003098273.1.15602 WP_003098273.1.15606 WP_003098273.1.15692 WP_003098273.1.15886 WP_003098273.1.15889 WP_003098273.1.15934 WP_003098273.1.16041 WP_003098273.1.16074 WP_003098273.1.16109 WP_003098273.1.16142 WP_003098273.1.16161 WP_003098273.1.16197 WP_003098273.1.162 WP_003098273.1.16239 WP_003098273.1.16242 WP_003098273.1.16267 WP_003098273.1.16419 WP_003098273.1.1646 WP_003098273.1.16660 WP_003098273.1.16694 WP_003098273.1.1670 WP_003098273.1.1671 WP_003098273.1.16751 WP_003098273.1.16782 WP_003098273.1.16788 WP_003098273.1.16801 WP_003098273.1.16808 WP_003098273.1.16811 WP_003098273.1.16895 WP_003098273.1.17022 WP_003098273.1.1704 WP_003098273.1.17108 WP_003098273.1.17155 WP_003098273.1.17162 WP_003098273.1.17177 WP_003098273.1.172 WP_003098273.1.17223 WP_003098273.1.17353 WP_003098273.1.17354 WP_003098273.1.17370 WP_003098273.1.1739 WP_003098273.1.17397 WP_003098273.1.17566 WP_003098273.1.1758 WP_003098273.1.1761 WP_003098273.1.17697 WP_003098273.1.17883 WP_003098273.1.17890 WP_003098273.1.18054 WP_003098273.1.18117 WP_003098273.1.18156 WP_003098273.1.18157 WP_003098273.1.18199 WP_003098273.1.18204 WP_003098273.1.18234 WP_003098273.1.1824 WP_003098273.1.18349 WP_003098273.1.18440 WP_003098273.1.18493 WP_003098273.1.18508 WP_003098273.1.18547 WP_003098273.1.18653 WP_003098273.1.18728 WP_003098273.1.18735 WP_003098273.1.18769 WP_003098273.1.18795 WP_003098273.1.18852 WP_003098273.1.18892 WP_003098273.1.18907 WP_003098273.1.18911 WP_003098273.1.18930 WP_003098273.1.190 WP_003098273.1.19089 WP_003098273.1.19199 WP_003098273.1.19260 WP_003098273.1.19269 WP_003098273.1.19346 WP_003098273.1.19351 WP_003098273.1.19376 WP_003098273.1.1938 WP_003098273.1.19552 WP_003098273.1.19591 WP_003098273.1.19640 WP_003098273.1.19703 WP_003098273.1.1971 WP_003098273.1.19711 WP_003098273.1.19718 WP_003098273.1.19741 WP_003098273.1.19771 WP_003098273.1.19803 WP_003098273.1.19824 WP_003098273.1.19930 WP_003098273.1.19931 WP_003098273.1.20024 WP_003098273.1.20070 WP_003098273.1.2012 WP_003098273.1.20125 WP_003098273.1.20154 WP_003098273.1.20216 WP_003098273.1.20342 WP_003098273.1.20682 WP_003098273.1.20692 WP_003098273.1.20744 WP_003098273.1.20764 WP_003098273.1.20825 WP_003098273.1.20854 WP_003098273.1.20880 WP_003098273.1.20884 WP_003098273.1.20890 WP_003098273.1.209 WP_003098273.1.20929 WP_003098273.1.20978 WP_003098273.1.21039 WP_003098273.1.21096 WP_003098273.1.21100 WP_003098273.1.21166 WP_003098273.1.21209 WP_003098273.1.21242 WP_003098273.1.21253 WP_003098273.1.21302 WP_003098273.1.21349 WP_003098273.1.21358 WP_003098273.1.2144 WP_003098273.1.21448 WP_003098273.1.21460 WP_003098273.1.21469 WP_003098273.1.21517 WP_003098273.1.21607 WP_003098273.1.2172 WP_003098273.1.21744 WP_003098273.1.21767 WP_003098273.1.21782 WP_003098273.1.21801 WP_003098273.1.21863 WP_003098273.1.21871 WP_003098273.1.21891 WP_003098273.1.21932 WP_003098273.1.22078 WP_003098273.1.221 WP_003098273.1.2228 WP_003098273.1.22316 WP_003098273.1.22324 WP_003098273.1.22389 WP_003098273.1.22390 WP_003098273.1.22394 WP_003098273.1.22442 WP_003098273.1.22477 WP_003098273.1.22491 WP_003098273.1.22573 WP_003098273.1.22671 WP_003098273.1.22704 WP_003098273.1.22729 WP_003098273.1.22863 WP_003098273.1.2289 WP_003098273.1.22891 WP_003098273.1.23013 WP_003098273.1.23166 WP_003098273.1.23191 WP_003098273.1.23195 WP_003098273.1.2323 WP_003098273.1.23264 WP_003098273.1.23331 WP_003098273.1.23394 WP_003098273.1.23418 WP_003098273.1.23421 WP_003098273.1.23512 WP_003098273.1.23523 WP_003098273.1.23525 WP_003098273.1.2355 WP_003098273.1.23559 WP_003098273.1.23581 WP_003098273.1.236 WP_003098273.1.23611 WP_003098273.1.23641 WP_003098273.1.23715 WP_003098273.1.23739 WP_003098273.1.2374 WP_003098273.1.23769 WP_003098273.1.23794 WP_003098273.1.23884 WP_003098273.1.23925 WP_003098273.1.23938 WP_003098273.1.23961 WP_003098273.1.23967 WP_003098273.1.23983 WP_003098273.1.24066 WP_003098273.1.24077 WP_003098273.1.24087 WP_003098273.1.24101 WP_003098273.1.24183 WP_003098273.1.24234 WP_003098273.1.24319 WP_003098273.1.24351 WP_003098273.1.24382 WP_003098273.1.24413 WP_003098273.1.24447 WP_003098273.1.2453 WP_003098273.1.24626 WP_003098273.1.24662 WP_003098273.1.2477 WP_003098273.1.24851 WP_003098273.1.24862 WP_003098273.1.24869 WP_003098273.1.24879 WP_003098273.1.24938 WP_003098273.1.24940 WP_003098273.1.25033 WP_003098273.1.25052 WP_003098273.1.25075 WP_003098273.1.251 WP_003098273.1.25109 WP_003098273.1.2511 WP_003098273.1.25142 WP_003098273.1.25149 WP_003098273.1.25179 WP_003098273.1.25191 WP_003098273.1.25271 WP_003098273.1.2529 WP_003098273.1.2530 WP_003098273.1.25328 WP_003098273.1.25344 WP_003098273.1.25348 WP_003098273.1.2535 WP_003098273.1.25477 WP_003098273.1.25532 WP_003098273.1.25600 WP_003098273.1.25675 WP_003098273.1.25695 WP_003098273.1.2572 WP_003098273.1.25834 WP_003098273.1.25903 WP_003098273.1.2596 WP_003098273.1.25964 WP_003098273.1.26010 WP_003098273.1.26025 WP_003098273.1.26042 WP_003098273.1.261 WP_003098273.1.26159 WP_003098273.1.26301 WP_003098273.1.26334 WP_003098273.1.26428 WP_003098273.1.26463 WP_003098273.1.26473 WP_003098273.1.26489 WP_003098273.1.2652 WP_003098273.1.26539 WP_003098273.1.26553 WP_003098273.1.26604 WP_003098273.1.26681 WP_003098273.1.26682 WP_003098273.1.26705 WP_003098273.1.26740 WP_003098273.1.26816 WP_003098273.1.26841 WP_003098273.1.26862 WP_003098273.1.26906 WP_003098273.1.26967 WP_003098273.1.2698 WP_003098273.1.27018 WP_003098273.1.27028 WP_003098273.1.27039 WP_003098273.1.27073 WP_003098273.1.27107 WP_003098273.1.27211 WP_003098273.1.27218 WP_003098273.1.27259 WP_003098273.1.27505 WP_003098273.1.27534 WP_003098273.1.27575 WP_003098273.1.27687 WP_003098273.1.27738 WP_003098273.1.27772 WP_003098273.1.27783 WP_003098273.1.27837 WP_003098273.1.27858 WP_003098273.1.27933 WP_003098273.1.27939 WP_003098273.1.27966 WP_003098273.1.28006 WP_003098273.1.28057 WP_003098273.1.28064 WP_003098273.1.28078 WP_003098273.1.28136 WP_003098273.1.28175 WP_003098273.1.28193 WP_003098273.1.28258 WP_003098273.1.283 WP_003098273.1.28316 WP_003098273.1.28329 WP_003098273.1.28372 WP_003098273.1.28382 WP_003098273.1.28383 WP_003098273.1.28404 WP_003098273.1.28468 WP_003098273.1.28505 WP_003098273.1.28528 WP_003098273.1.28560 WP_003098273.1.28602 WP_003098273.1.28623 WP_003098273.1.28699 WP_003098273.1.28713 WP_003098273.1.28757 WP_003098273.1.28823 WP_003098273.1.28838 WP_003098273.1.28849 WP_003098273.1.28920 WP_003098273.1.29003 WP_003098273.1.29062 WP_003098273.1.29096 WP_003098273.1.29127 WP_003098273.1.29137 WP_003098273.1.29158 WP_003098273.1.29179 WP_003098273.1.29208 WP_003098273.1.29401 WP_003098273.1.2941 WP_003098273.1.29438 WP_003098273.1.29440 WP_003098273.1.29472 WP_003098273.1.2948 WP_003098273.1.29481 WP_003098273.1.29501 WP_003098273.1.29577 WP_003098273.1.2961 WP_003098273.1.29633 WP_003098273.1.29668 WP_003098273.1.29753 WP_003098273.1.29767 WP_003098273.1.2980 WP_003098273.1.29848 WP_003098273.1.29920 WP_003098273.1.29958 WP_003098273.1.29973 WP_003098273.1.30000 WP_003098273.1.30081 WP_003098273.1.30120 WP_003098273.1.30365 WP_003098273.1.30474 WP_003098273.1.30475 WP_003098273.1.30563 WP_003098273.1.30567 WP_003098273.1.30614 WP_003098273.1.30615 WP_003098273.1.30693 WP_003098273.1.30707 WP_003098273.1.3072 WP_003098273.1.30740 WP_003098273.1.30797 WP_003098273.1.30810 WP_003098273.1.30815 WP_003098273.1.30886 WP_003098273.1.30943 WP_003098273.1.30973 WP_003098273.1.31045 WP_003098273.1.31076 WP_003098273.1.31087 WP_003098273.1.31103 WP_003098273.1.31105 WP_003098273.1.31138 WP_003098273.1.31147 WP_003098273.1.31279 WP_003098273.1.31361 WP_003098273.1.31457 WP_003098273.1.31501 WP_003098273.1.31563 WP_003098273.1.31565 WP_003098273.1.31587 WP_003098273.1.31655 WP_003098273.1.3172 WP_003098273.1.31732 WP_003098273.1.31741 WP_003098273.1.3179 WP_003098273.1.31848 WP_003098273.1.31852 WP_003098273.1.3189 WP_003098273.1.319 WP_003098273.1.31939 WP_003098273.1.32134 WP_003098273.1.32137 WP_003098273.1.32144 WP_003098273.1.32314 WP_003098273.1.32359 WP_003098273.1.32447 WP_003098273.1.32523 WP_003098273.1.32544 WP_003098273.1.32596 WP_003098273.1.32637 WP_003098273.1.32641 WP_003098273.1.32711 WP_003098273.1.32821 WP_003098273.1.32869 WP_003098273.1.32879 WP_003098273.1.32998 WP_003098273.1.33009 WP_003098273.1.33047 WP_003098273.1.33097 WP_003098273.1.33133 WP_003098273.1.33152 WP_003098273.1.33186 WP_003098273.1.33204 WP_003098273.1.33210 WP_003098273.1.33216 WP_003098273.1.33294 WP_003098273.1.33340 WP_003098273.1.33387 WP_003098273.1.33438 WP_003098273.1.33441 WP_003098273.1.33455 WP_003098273.1.3351 WP_003098273.1.33517 WP_003098273.1.33521 WP_003098273.1.33523 WP_003098273.1.33547 WP_003098273.1.33549 WP_003098273.1.33653 WP_003098273.1.33658 WP_003098273.1.33669 WP_003098273.1.3368 WP_003098273.1.33733 WP_003098273.1.33734 WP_003098273.1.3376 WP_003098273.1.33774 WP_003098273.1.33801 WP_003098273.1.33814 WP_003098273.1.33822 WP_003098273.1.33824 WP_003098273.1.33833 WP_003098273.1.3385 WP_003098273.1.34000 WP_003098273.1.34039 WP_003098273.1.34136 WP_003098273.1.34143 WP_003098273.1.34151 WP_003098273.1.34180 WP_003098273.1.34191 WP_003098273.1.34203 WP_003098273.1.34306 WP_003098273.1.34324 WP_003098273.1.3436 WP_003098273.1.34401 WP_003098273.1.34402 WP_003098273.1.34461 WP_003098273.1.34465 WP_003098273.1.34472 WP_003098273.1.34556 WP_003098273.1.34583 WP_003098273.1.34625 WP_003098273.1.34670 WP_003098273.1.34689 WP_003098273.1.34731 WP_003098273.1.34784 WP_003098273.1.34821 WP_003098273.1.34832 WP_003098273.1.34836 WP_003098273.1.34876 WP_003098273.1.34878 WP_003098273.1.34901 WP_003098273.1.34922 WP_003098273.1.35036 WP_003098273.1.35104 WP_003098273.1.35149 WP_003098273.1.35231 WP_003098273.1.35281 WP_003098273.1.3531 WP_003098273.1.35325 WP_003098273.1.35353 WP_003098273.1.3540 WP_003098273.1.35431 WP_003098273.1.35442 WP_003098273.1.35480 WP_003098273.1.35512 WP_003098273.1.35573 WP_003098273.1.35639 WP_003098273.1.35641 WP_003098273.1.35669 WP_003098273.1.35679 WP_003098273.1.3568 WP_003098273.1.35682 WP_003098273.1.3576 WP_003098273.1.35762 WP_003098273.1.35768 WP_003098273.1.35822 WP_003098273.1.35843 WP_003098273.1.35857 WP_003098273.1.35872 WP_003098273.1.35968 WP_003098273.1.35984 WP_003098273.1.36064 WP_003098273.1.36121 WP_003098273.1.36170 WP_003098273.1.36266 WP_003098273.1.36267 WP_003098273.1.36378 WP_003098273.1.36435 WP_003098273.1.36487 WP_003098273.1.36521 WP_003098273.1.3653 WP_003098273.1.36587 WP_003098273.1.36608 WP_003098273.1.3662 WP_003098273.1.36665 WP_003098273.1.36708 WP_003098273.1.3672 WP_003098273.1.36756 WP_003098273.1.36781 WP_003098273.1.36879 WP_003098273.1.37050 WP_003098273.1.37097 WP_003098273.1.37125 WP_003098273.1.37163 WP_003098273.1.37208 WP_003098273.1.3721 WP_003098273.1.37216 WP_003098273.1.373 WP_003098273.1.37319 WP_003098273.1.37366 WP_003098273.1.37416 WP_003098273.1.37500 WP_003098273.1.37512 WP_003098273.1.37571 WP_003098273.1.3768 WP_003098273.1.37698 WP_003098273.1.37703 WP_003098273.1.3773 WP_003098273.1.3781 WP_003098273.1.37818 WP_003098273.1.37826 WP_003098273.1.37842 WP_003098273.1.3785 WP_003098273.1.3792 WP_003098273.1.38003 WP_003098273.1.38023 WP_003098273.1.38060 WP_003098273.1.38087 WP_003098273.1.38102 WP_003098273.1.38146 WP_003098273.1.38151 WP_003098273.1.3818 WP_003098273.1.38186 WP_003098273.1.3821 WP_003098273.1.38319 WP_003098273.1.3833 WP_003098273.1.38337 WP_003098273.1.38406 WP_003098273.1.38430 WP_003098273.1.38450 WP_003098273.1.38502 WP_003098273.1.38505 WP_003098273.1.38510 WP_003098273.1.38582 WP_003098273.1.38583 WP_003098273.1.38587 WP_003098273.1.38657 WP_003098273.1.38661 WP_003098273.1.38706 WP_003098273.1.38727 WP_003098273.1.38816 WP_003098273.1.38834 WP_003098273.1.3887 WP_003098273.1.38889 WP_003098273.1.38932 WP_003098273.1.39046 WP_003098273.1.39088 WP_003098273.1.39122 WP_003098273.1.39186 WP_003098273.1.39271 WP_003098273.1.39326 WP_003098273.1.39345 WP_003098273.1.3943 WP_003098273.1.39444 WP_003098273.1.39452 WP_003098273.1.39458 WP_003098273.1.39537 WP_003098273.1.39704 WP_003098273.1.39765 WP_003098273.1.39786 WP_003098273.1.39811 WP_003098273.1.39949 WP_003098273.1.3998 WP_003098273.1.39989 WP_003098273.1.40059 WP_003098273.1.40115 WP_003098273.1.40135 WP_003098273.1.40207 WP_003098273.1.40213 WP_003098273.1.40237 WP_003098273.1.40243 WP_003098273.1.40419 WP_003098273.1.40442 WP_003098273.1.40512 WP_003098273.1.40513 WP_003098273.1.40541 WP_003098273.1.40546 WP_003098273.1.4058 WP_003098273.1.40595 WP_003098273.1.40703 WP_003098273.1.40874 WP_003098273.1.40950 WP_003098273.1.40984 WP_003098273.1.40993 WP_003098273.1.40994 WP_003098273.1.41110 WP_003098273.1.41290 WP_003098273.1.41291 WP_003098273.1.41301 WP_003098273.1.41412 WP_003098273.1.41429 WP_003098273.1.41487 WP_003098273.1.41492 WP_003098273.1.41502 WP_003098273.1.4156 WP_003098273.1.41618 WP_003098273.1.41624 WP_003098273.1.41625 WP_003098273.1.41692 WP_003098273.1.41703 WP_003098273.1.41732 WP_003098273.1.41773 WP_003098273.1.41832 WP_003098273.1.41846 WP_003098273.1.41871 WP_003098273.1.41888 WP_003098273.1.4190 WP_003098273.1.41939 WP_003098273.1.4196 WP_003098273.1.42 WP_003098273.1.42019 WP_003098273.1.42041 WP_003098273.1.42047 WP_003098273.1.42146 WP_003098273.1.42259 WP_003098273.1.42294 WP_003098273.1.42316 WP_003098273.1.42381 WP_003098273.1.42388 WP_003098273.1.42411 WP_003098273.1.42423 WP_003098273.1.42463 WP_003098273.1.42499 WP_003098273.1.42508 WP_003098273.1.42643 WP_003098273.1.42696 WP_003098273.1.42754 WP_003098273.1.42757 WP_003098273.1.42789 WP_003098273.1.42854 WP_003098273.1.42856 WP_003098273.1.42870 WP_003098273.1.42917 WP_003098273.1.42946 WP_003098273.1.42952 WP_003098273.1.42972 WP_003098273.1.42973 WP_003098273.1.43022 WP_003098273.1.43024 WP_003098273.1.43049 WP_003098273.1.43106 WP_003098273.1.43107 WP_003098273.1.43245 WP_003098273.1.43286 WP_003098273.1.43293 WP_003098273.1.43356 WP_003098273.1.4348 WP_003098273.1.43593 WP_003098273.1.43603 WP_003098273.1.43662 WP_003098273.1.43667 WP_003098273.1.43673 WP_003098273.1.43696 WP_003098273.1.43729 WP_003098273.1.43756 WP_003098273.1.43783 WP_003098273.1.43802 WP_003098273.1.4381 WP_003098273.1.43811 WP_003098273.1.43826 WP_003098273.1.4397 WP_003098273.1.4398 WP_003098273.1.43998 WP_003098273.1.44046 WP_003098273.1.44094 WP_003098273.1.44213 WP_003098273.1.44260 WP_003098273.1.44373 WP_003098273.1.44434 WP_003098273.1.44486 WP_003098273.1.44563 WP_003098273.1.44565 WP_003098273.1.44581 WP_003098273.1.44725 WP_003098273.1.44739 WP_003098273.1.44760 WP_003098273.1.4493 WP_003098273.1.44959 WP_003098273.1.45063 WP_003098273.1.45090 WP_003098273.1.45146 WP_003098273.1.45199 WP_003098273.1.45202 WP_003098273.1.4522 WP_003098273.1.45298 WP_003098273.1.45306 WP_003098273.1.45328 WP_003098273.1.45353 WP_003098273.1.45358 WP_003098273.1.45464 WP_003098273.1.45478 WP_003098273.1.45485 WP_003098273.1.45604 WP_003098273.1.45635 WP_003098273.1.45636 WP_003098273.1.45678 WP_003098273.1.45700 WP_003098273.1.45711 WP_003098273.1.45723 WP_003098273.1.45818 WP_003098273.1.45837 WP_003098273.1.45920 WP_003098273.1.45934 WP_003098273.1.45961 WP_003098273.1.46010 WP_003098273.1.46032 WP_003098273.1.46093 WP_003098273.1.461 WP_003098273.1.46152 WP_003098273.1.46200 WP_003098273.1.46306 WP_003098273.1.46502 WP_003098273.1.46623 WP_003098273.1.46633 WP_003098273.1.46755 WP_003098273.1.46787 WP_003098273.1.46826 WP_003098273.1.46846 WP_003098273.1.46866 WP_003098273.1.46885 WP_003098273.1.46926 WP_003098273.1.46935 WP_003098273.1.4699 WP_003098273.1.47101 WP_003098273.1.47150 WP_003098273.1.47155 WP_003098273.1.47158 WP_003098273.1.47251 WP_003098273.1.4726 WP_003098273.1.47296 WP_003098273.1.47312 WP_003098273.1.47314 WP_003098273.1.47374 WP_003098273.1.47469 WP_003098273.1.47480 WP_003098273.1.47527 WP_003098273.1.47598 WP_003098273.1.47645 WP_003098273.1.47774 WP_003098273.1.47930 WP_003098273.1.47934 WP_003098273.1.47970 WP_003098273.1.48001 WP_003098273.1.48024 WP_003098273.1.48086 WP_003098273.1.48094 WP_003098273.1.48141 WP_003098273.1.48172 WP_003098273.1.48178 WP_003098273.1.48334 WP_003098273.1.4836 WP_003098273.1.48378 WP_003098273.1.48382 WP_003098273.1.48413 WP_003098273.1.48472 WP_003098273.1.48474 WP_003098273.1.48487 WP_003098273.1.48545 WP_003098273.1.48546 WP_003098273.1.48576 WP_003098273.1.48810 WP_003098273.1.48820 WP_003098273.1.48842 WP_003098273.1.48851 WP_003098273.1.48870 WP_003098273.1.48990 WP_003098273.1.49108 WP_003098273.1.49135 WP_003098273.1.49184 WP_003098273.1.49244 WP_003098273.1.49265 WP_003098273.1.49266 WP_003098273.1.49277 WP_003098273.1.49286 WP_003098273.1.49293 WP_003098273.1.49360 WP_003098273.1.49416 WP_003098273.1.49500 WP_003098273.1.49557 WP_003098273.1.49566 WP_003098273.1.49688 WP_003098273.1.49798 WP_003098273.1.49806 WP_003098273.1.49833 WP_003098273.1.49842 WP_003098273.1.49922 WP_003098273.1.49948 WP_003098273.1.49976 WP_003098273.1.49988 WP_003098273.1.49998 WP_003098273.1.50176 WP_003098273.1.50180 WP_003098273.1.50222 WP_003098273.1.50232 WP_003098273.1.50242 WP_003098273.1.5043 WP_003098273.1.50459 WP_003098273.1.50567 WP_003098273.1.50653 WP_003098273.1.50665 WP_003098273.1.50668 WP_003098273.1.50682 WP_003098273.1.50691 WP_003098273.1.50734 WP_003098273.1.50783 WP_003098273.1.50814 WP_003098273.1.50922 WP_003098273.1.50967 WP_003098273.1.50989 WP_003098273.1.51019 WP_003098273.1.51035 WP_003098273.1.51141 WP_003098273.1.51173 WP_003098273.1.51183 WP_003098273.1.51267 WP_003098273.1.51273 WP_003098273.1.5132 WP_003098273.1.51457 WP_003098273.1.51472 WP_003098273.1.51538 WP_003098273.1.51549 WP_003098273.1.51585 WP_003098273.1.51682 WP_003098273.1.51727 WP_003098273.1.51733 WP_003098273.1.51807 WP_003098273.1.51847 WP_003098273.1.51889 WP_003098273.1.51917 WP_003098273.1.51928 WP_003098273.1.51937 WP_003098273.1.51943 WP_003098273.1.51957 WP_003098273.1.51976 WP_003098273.1.52043 WP_003098273.1.52146 WP_003098273.1.52152 WP_003098273.1.52212 WP_003098273.1.52220 WP_003098273.1.52244 WP_003098273.1.52326 WP_003098273.1.52334 WP_003098273.1.5235 WP_003098273.1.52355 WP_003098273.1.52409 WP_003098273.1.52449 WP_003098273.1.52500 WP_003098273.1.52537 WP_003098273.1.5258 WP_003098273.1.52583 WP_003098273.1.5260 WP_003098273.1.52690 WP_003098273.1.52700 WP_003098273.1.52728 WP_003098273.1.52784 WP_003098273.1.52790 WP_003098273.1.52810 WP_003098273.1.52850 WP_003098273.1.52868 WP_003098273.1.5294 WP_003098273.1.53038 WP_003098273.1.53070 WP_003098273.1.53072 WP_003098273.1.53169 WP_003098273.1.53267 WP_003098273.1.53287 WP_003098273.1.53351 WP_003098273.1.53371 WP_003098273.1.53414 WP_003098273.1.53427 WP_003098273.1.53486 WP_003098273.1.53528 WP_003098273.1.53530 WP_003098273.1.53663 WP_003098273.1.53678 WP_003098273.1.53719 WP_003098273.1.53726 WP_003098273.1.53826 WP_003098273.1.53932 WP_003098273.1.53948 WP_003098273.1.53951 WP_003098273.1.5399 WP_003098273.1.54003 WP_003098273.1.54078 WP_003098273.1.54090 WP_003098273.1.54133 WP_003098273.1.54140 WP_003098273.1.54146 WP_003098273.1.5420 WP_003098273.1.5427 WP_003098273.1.54293 WP_003098273.1.54354 WP_003098273.1.54362 WP_003098273.1.54462 WP_003098273.1.54497 WP_003098273.1.54571 WP_003098273.1.54742 WP_003098273.1.54809 WP_003098273.1.54974 WP_003098273.1.55089 WP_003098273.1.55169 WP_003098273.1.55245 WP_003098273.1.55318 WP_003098273.1.55347 WP_003098273.1.55387 WP_003098273.1.55400 WP_003098273.1.55445 WP_003098273.1.55478 WP_003098273.1.55543 WP_003098273.1.55729 WP_003098273.1.55813 WP_003098273.1.55976 WP_003098273.1.56013 WP_003098273.1.56145 WP_003098273.1.56171 WP_003098273.1.56187 WP_003098273.1.56188 WP_003098273.1.56196 WP_003098273.1.56228 WP_003098273.1.56229 WP_003098273.1.56315 WP_003098273.1.56348 WP_003098273.1.56442 WP_003098273.1.56452 WP_003098273.1.56465 WP_003098273.1.56474 WP_003098273.1.56475 WP_003098273.1.56623 WP_003098273.1.56626 WP_003098273.1.56632 WP_003098273.1.56745 WP_003098273.1.56768 WP_003098273.1.56797 WP_003098273.1.56808 WP_003098273.1.56819 WP_003098273.1.56837 WP_003098273.1.56850 WP_003098273.1.56864 WP_003098273.1.56896 WP_003098273.1.56943 WP_003098273.1.57005 WP_003098273.1.57020 WP_003098273.1.57113 WP_003098273.1.57131 WP_003098273.1.57140 WP_003098273.1.57276 WP_003098273.1.5731 WP_003098273.1.57339 WP_003098273.1.57369 WP_003098273.1.57417 WP_003098273.1.57460 WP_003098273.1.57477 WP_003098273.1.57480 WP_003098273.1.57532 WP_003098273.1.57548 WP_003098273.1.57566 WP_003098273.1.57728 WP_003098273.1.57792 WP_003098273.1.57839 WP_003098273.1.57841 WP_003098273.1.57853 WP_003098273.1.57966 WP_003098273.1.58019 WP_003098273.1.58056 WP_003098273.1.58155 WP_003098273.1.58162 WP_003098273.1.58183 WP_003098273.1.58193 WP_003098273.1.58200 WP_003098273.1.58228 WP_003098273.1.58294 WP_003098273.1.58360 WP_003098273.1.58417 WP_003098273.1.58436 WP_003098273.1.58482 WP_003098273.1.5850 WP_003098273.1.58510 WP_003098273.1.58527 WP_003098273.1.5856 WP_003098273.1.58689 WP_003098273.1.5869 WP_003098273.1.58785 WP_003098273.1.58800 WP_003098273.1.58838 WP_003098273.1.58845 WP_003098273.1.5889 WP_003098273.1.58944 WP_003098273.1.58952 WP_003098273.1.59013 WP_003098273.1.59076 WP_003098273.1.59099 WP_003098273.1.59158 WP_003098273.1.59176 WP_003098273.1.59212 WP_003098273.1.59246 WP_003098273.1.59249 WP_003098273.1.59250 WP_003098273.1.5937 WP_003098273.1.59376 WP_003098273.1.594 WP_003098273.1.59469 WP_003098273.1.59563 WP_003098273.1.59688 WP_003098273.1.59724 WP_003098273.1.59759 WP_003098273.1.59797 WP_003098273.1.59831 WP_003098273.1.59870 WP_003098273.1.60051 WP_003098273.1.60062 WP_003098273.1.60079 WP_003098273.1.60082 WP_003098273.1.60084 WP_003098273.1.60085 WP_003098273.1.60206 WP_003098273.1.60261 WP_003098273.1.60347 WP_003098273.1.60364 WP_003098273.1.60396 WP_003098273.1.60415 WP_003098273.1.60467 WP_003098273.1.60472 WP_003098273.1.60509 WP_003098273.1.60600 WP_003098273.1.60602 WP_003098273.1.60603 WP_003098273.1.60639 WP_003098273.1.60679 WP_003098273.1.60686 WP_003098273.1.607 WP_003098273.1.60850 WP_003098273.1.60910 WP_003098273.1.60916 WP_003098273.1.60970 WP_003098273.1.60979 WP_003098273.1.61122 WP_003098273.1.61130 WP_003098273.1.61191 WP_003098273.1.61209 WP_003098273.1.61222 WP_003098273.1.61269 WP_003098273.1.61288 WP_003098273.1.61294 WP_003098273.1.61299 WP_003098273.1.6130 WP_003098273.1.61366 WP_003098273.1.61431 WP_003098273.1.61493 WP_003098273.1.61549 WP_003098273.1.61589 WP_003098273.1.61598 WP_003098273.1.61696 WP_003098273.1.6173 WP_003098273.1.61943 WP_003098273.1.62010 WP_003098273.1.62035 WP_003098273.1.62180 WP_003098273.1.62186 WP_003098273.1.62357 WP_003098273.1.62396 WP_003098273.1.62410 WP_003098273.1.62483 WP_003098273.1.6249 WP_003098273.1.62516 WP_003098273.1.62534 WP_003098273.1.626 WP_003098273.1.62604 WP_003098273.1.62635 WP_003098273.1.62688 WP_003098273.1.62701 WP_003098273.1.62703 WP_003098273.1.62704 WP_003098273.1.62708 WP_003098273.1.62716 WP_003098273.1.62768 WP_003098273.1.62772 WP_003098273.1.6280 WP_003098273.1.6283 WP_003098273.1.62834 WP_003098273.1.62838 WP_003098273.1.62873 WP_003098273.1.62917 WP_003098273.1.62977 WP_003098273.1.63041 WP_003098273.1.63057 WP_003098273.1.63124 WP_003098273.1.63193 WP_003098273.1.63196 WP_003098273.1.63338 WP_003098273.1.63369 WP_003098273.1.63401 WP_003098273.1.63591 WP_003098273.1.63597 WP_003098273.1.63634 WP_003098273.1.63659 WP_003098273.1.63739 WP_003098273.1.63784 WP_003098273.1.63989 WP_003098273.1.63995 WP_003098273.1.64139 WP_003098273.1.64155 WP_003098273.1.64198 WP_003098273.1.64212 WP_003098273.1.64309 WP_003098273.1.64329 WP_003098273.1.64340 WP_003098273.1.64433 WP_003098273.1.6450 WP_003098273.1.64544 WP_003098273.1.64591 WP_003098273.1.64603 WP_003098273.1.6461 WP_003098273.1.64726 WP_003098273.1.64748 WP_003098273.1.64799 WP_003098273.1.64807 WP_003098273.1.64854 WP_003098273.1.64862 WP_003098273.1.64880 WP_003098273.1.64885 WP_003098273.1.64886 WP_003098273.1.64983 WP_003098273.1.64984 WP_003098273.1.65009 WP_003098273.1.65066 WP_003098273.1.65092 WP_003098273.1.65095 WP_003098273.1.65099 WP_003098273.1.65145 WP_003098273.1.65196 WP_003098273.1.65197 WP_003098273.1.65227 WP_003098273.1.65237 WP_003098273.1.65247 WP_003098273.1.65304 WP_003098273.1.65312 WP_003098273.1.65316 WP_003098273.1.65334 WP_003098273.1.65335 WP_003098273.1.65337 WP_003098273.1.65457 WP_003098273.1.65549 WP_003098273.1.65588 WP_003098273.1.65632 WP_003098273.1.65642 WP_003098273.1.65679 WP_003098273.1.65740 WP_003098273.1.65779 WP_003098273.1.65819 WP_003098273.1.65867 WP_003098273.1.6589 WP_003098273.1.65926 WP_003098273.1.66062 WP_003098273.1.66155 WP_003098273.1.66165 WP_003098273.1.6627 WP_003098273.1.66277 WP_003098273.1.6629 WP_003098273.1.66345 WP_003098273.1.66348 WP_003098273.1.66364 WP_003098273.1.66371 WP_003098273.1.66410 WP_003098273.1.66526 WP_003098273.1.66563 WP_003098273.1.66584 WP_003098273.1.66634 WP_003098273.1.66721 WP_003098273.1.66929 WP_003098273.1.66931 WP_003098273.1.66945 WP_003098273.1.66950 WP_003098273.1.66982 WP_003098273.1.67010 WP_003098273.1.67188 WP_003098273.1.67205 WP_003098273.1.67261 WP_003098273.1.67269 WP_003098273.1.6734 WP_003098273.1.67370 WP_003098273.1.67388 WP_003098273.1.67472 WP_003098273.1.67489 WP_003098273.1.67506 WP_003098273.1.67526 WP_003098273.1.67531 WP_003098273.1.67545 WP_003098273.1.6768 WP_003098273.1.67686 WP_003098273.1.67755 WP_003098273.1.67830 WP_003098273.1.67875 WP_003098273.1.67899 WP_003098273.1.67903 WP_003098273.1.67937 WP_003098273.1.67948 WP_003098273.1.68000 WP_003098273.1.6808 WP_003098273.1.68158 WP_003098273.1.68162 WP_003098273.1.68172 WP_003098273.1.68183 WP_003098273.1.68194 WP_003098273.1.68252 WP_003098273.1.68317 WP_003098273.1.68499 WP_003098273.1.6850 WP_003098273.1.68541 WP_003098273.1.68561 WP_003098273.1.68568 WP_003098273.1.68638 WP_003098273.1.68756 WP_003098273.1.68781 WP_003098273.1.68790 WP_003098273.1.68800 WP_003098273.1.68802 WP_003098273.1.68850 WP_003098273.1.68857 WP_003098273.1.68862 WP_003098273.1.68881 WP_003098273.1.68910 WP_003098273.1.68938 WP_003098273.1.68979 WP_003098273.1.6911 WP_003098273.1.69159 WP_003098273.1.69209 WP_003098273.1.69260 WP_003098273.1.6928 WP_003098273.1.6931 WP_003098273.1.69411 WP_003098273.1.69534 WP_003098273.1.69556 WP_003098273.1.69599 WP_003098273.1.69702 WP_003098273.1.69788 WP_003098273.1.69791 WP_003098273.1.69819 WP_003098273.1.69907 WP_003098273.1.69993 WP_003098273.1.70092 WP_003098273.1.70098 WP_003098273.1.70138 WP_003098273.1.70194 WP_003098273.1.70216 WP_003098273.1.70229 WP_003098273.1.70331 WP_003098273.1.70460 WP_003098273.1.70470 WP_003098273.1.70537 WP_003098273.1.70561 WP_003098273.1.70583 WP_003098273.1.70648 WP_003098273.1.70670 WP_003098273.1.70677 WP_003098273.1.70693 WP_003098273.1.7077 WP_003098273.1.70778 WP_003098273.1.70831 WP_003098273.1.70991 WP_003098273.1.71038 WP_003098273.1.71141 WP_003098273.1.71203 WP_003098273.1.71234 WP_003098273.1.71249 WP_003098273.1.71254 WP_003098273.1.7128 WP_003098273.1.71385 WP_003098273.1.71412 WP_003098273.1.71570 WP_003098273.1.7163 WP_003098273.1.71642 WP_003098273.1.71666 WP_003098273.1.71738 WP_003098273.1.71799 WP_003098273.1.71806 WP_003098273.1.71822 WP_003098273.1.71862 WP_003098273.1.71866 WP_003098273.1.71891 WP_003098273.1.71934 WP_003098273.1.72149 WP_003098273.1.72167 WP_003098273.1.72181 WP_003098273.1.72183 WP_003098273.1.72287 WP_003098273.1.72323 WP_003098273.1.72331 WP_003098273.1.72346 WP_003098273.1.72378 WP_003098273.1.72447 WP_003098273.1.72477 WP_003098273.1.72541 WP_003098273.1.72562 WP_003098273.1.72570 WP_003098273.1.72653 WP_003098273.1.72669 WP_003098273.1.72727 WP_003098273.1.7276 WP_003098273.1.72768 WP_003098273.1.72772 WP_003098273.1.72845 WP_003098273.1.72920 WP_003098273.1.73048 WP_003098273.1.7308 WP_003098273.1.73135 WP_003098273.1.73149 WP_003098273.1.73172 WP_003098273.1.73192 WP_003098273.1.7327 WP_003098273.1.7329 WP_003098273.1.733 WP_003098273.1.73455 WP_003098273.1.73490 WP_003098273.1.73523 WP_003098273.1.73541 WP_003098273.1.73601 WP_003098273.1.73609 WP_003098273.1.73651 WP_003098273.1.73719 WP_003098273.1.73728 WP_003098273.1.7377 WP_003098273.1.73791 WP_003098273.1.7382 WP_003098273.1.73860 WP_003098273.1.73889 WP_003098273.1.73911 WP_003098273.1.73941 WP_003098273.1.74 WP_003098273.1.74000 WP_003098273.1.74072 WP_003098273.1.74074 WP_003098273.1.7408 WP_003098273.1.74106 WP_003098273.1.74167 WP_003098273.1.74175 WP_003098273.1.74180 WP_003098273.1.74182 WP_003098273.1.74219 WP_003098273.1.74268 WP_003098273.1.74281 WP_003098273.1.74287 WP_003098273.1.74326 WP_003098273.1.7445 WP_003098273.1.74458 WP_003098273.1.74473 WP_003098273.1.7448 WP_003098273.1.74518 WP_003098273.1.7456 WP_003098273.1.74568 WP_003098273.1.74604 WP_003098273.1.74629 WP_003098273.1.74637 WP_003098273.1.74685 WP_003098273.1.74772 WP_003098273.1.74776 WP_003098273.1.748 WP_003098273.1.74878 WP_003098273.1.74941 WP_003098273.1.74948 WP_003098273.1.74958 WP_003098273.1.75041 WP_003098273.1.75119 WP_003098273.1.75204 WP_003098273.1.75303 WP_003098273.1.75431 WP_003098273.1.7547 WP_003098273.1.75549 WP_003098273.1.75573 WP_003098273.1.75580 WP_003098273.1.75599 WP_003098273.1.75603 WP_003098273.1.75631 WP_003098273.1.75771 WP_003098273.1.75792 WP_003098273.1.75825 WP_003098273.1.75826 WP_003098273.1.75860 WP_003098273.1.75935 WP_003098273.1.75938 WP_003098273.1.75947 WP_003098273.1.7595 WP_003098273.1.76077 WP_003098273.1.76141 WP_003098273.1.76145 WP_003098273.1.76192 WP_003098273.1.76322 WP_003098273.1.76355 WP_003098273.1.76383 WP_003098273.1.76399 WP_003098273.1.76441 WP_003098273.1.76467 WP_003098273.1.76484 WP_003098273.1.76543 WP_003098273.1.76600 WP_003098273.1.7666 WP_003098273.1.76716 WP_003098273.1.76775 WP_003098273.1.76791 WP_003098273.1.76861 WP_003098273.1.76922 WP_003098273.1.76985 WP_003098273.1.77235 WP_003098273.1.77238 WP_003098273.1.77286 WP_003098273.1.77317 WP_003098273.1.77490 WP_003098273.1.77566 WP_003098273.1.77574 WP_003098273.1.77587 WP_003098273.1.77750 WP_003098273.1.77769 WP_003098273.1.7779 WP_003098273.1.77819 WP_003098273.1.77834 WP_003098273.1.77913 WP_003098273.1.78104 WP_003098273.1.78112 WP_003098273.1.78118 WP_003098273.1.78134 WP_003098273.1.78148 WP_003098273.1.78158 WP_003098273.1.78280 WP_003098273.1.78288 WP_003098273.1.78380 WP_003098273.1.7840 WP_003098273.1.78409 WP_003098273.1.78425 WP_003098273.1.78430 WP_003098273.1.78437 WP_003098273.1.78570 WP_003098273.1.78623 WP_003098273.1.78669 WP_003098273.1.78693 WP_003098273.1.78795 WP_003098273.1.788 WP_003098273.1.78810 WP_003098273.1.78926 WP_003098273.1.78954 WP_003098273.1.78986 WP_003098273.1.7899 WP_003098273.1.79007 WP_003098273.1.79177 WP_003098273.1.79193 WP_003098273.1.79256 WP_003098273.1.79279 WP_003098273.1.79286 WP_003098273.1.79311 WP_003098273.1.79357 WP_003098273.1.79364 WP_003098273.1.79421 WP_003098273.1.79429 WP_003098273.1.79431 WP_003098273.1.7945 WP_003098273.1.79507 WP_003098273.1.7953 WP_003098273.1.79544 WP_003098273.1.79569 WP_003098273.1.79601 WP_003098273.1.79631 WP_003098273.1.79754 WP_003098273.1.79788 WP_003098273.1.79862 WP_003098273.1.79883 WP_003098273.1.799 WP_003098273.1.79902 WP_003098273.1.79908 WP_003098273.1.79986 WP_003098273.1.8 WP_003098273.1.80033 WP_003098273.1.80087 WP_003098273.1.80102 WP_003098273.1.8013 WP_003098273.1.80174 WP_003098273.1.80258 WP_003098273.1.8028 WP_003098273.1.80306 WP_003098273.1.8038 WP_003098273.1.80410 WP_003098273.1.80454 WP_003098273.1.80481 WP_003098273.1.8051 WP_003098273.1.80535 WP_003098273.1.80572 WP_003098273.1.80627 WP_003098273.1.80632 WP_003098273.1.8064 WP_003098273.1.80644 WP_003098273.1.80645 WP_003098273.1.80683 WP_003098273.1.80785 WP_003098273.1.80846 WP_003098273.1.80880 WP_003098273.1.80892 WP_003098273.1.80910 WP_003098273.1.80929 WP_003098273.1.80931 WP_003098273.1.80938 WP_003098273.1.80969 WP_003098273.1.81081 WP_003098273.1.81082 WP_003098273.1.8110 WP_003098273.1.81206 WP_003098273.1.81368 WP_003098273.1.81380 WP_003098273.1.81426 WP_003098273.1.81470 WP_003098273.1.81482 WP_003098273.1.81487 WP_003098273.1.81581 WP_003098273.1.81591 WP_003098273.1.81622 WP_003098273.1.81643 WP_003098273.1.81708 WP_003098273.1.81728 WP_003098273.1.81742 WP_003098273.1.81748 WP_003098273.1.81771 WP_003098273.1.81784 WP_003098273.1.81802 WP_003098273.1.81816 WP_003098273.1.81834 WP_003098273.1.81844 WP_003098273.1.81856 WP_003098273.1.81874 WP_003098273.1.81927 WP_003098273.1.81950 WP_003098273.1.81957 WP_003098273.1.81960 WP_003098273.1.81986 WP_003098273.1.82117 WP_003098273.1.82127 WP_003098273.1.82178 WP_003098273.1.82260 WP_003098273.1.8227 WP_003098273.1.82312 WP_003098273.1.82328 WP_003098273.1.82334 WP_003098273.1.8238 WP_003098273.1.82442 WP_003098273.1.82487 WP_003098273.1.82580 WP_003098273.1.82604 WP_003098273.1.82606 WP_003098273.1.82620 WP_003098273.1.82643 WP_003098273.1.82686 WP_003098273.1.82710 WP_003098273.1.8284 WP_003098273.1.82864 WP_003098273.1.82882 WP_003098273.1.82887 WP_003098273.1.82936 WP_003098273.1.83025 WP_003098273.1.83131 WP_003098273.1.83184 WP_003098273.1.83213 WP_003098273.1.83251 WP_003098273.1.83267 WP_003098273.1.83296 WP_003098273.1.83317 WP_003098273.1.83374 WP_003098273.1.83394 WP_003098273.1.83440 WP_003098273.1.83460 WP_003098273.1.83463 WP_003098273.1.835 WP_003098273.1.83503 WP_003098273.1.83534 WP_003098273.1.83540 WP_003098273.1.83637 WP_003098273.1.83673 WP_003098273.1.83698 WP_003098273.1.83715 WP_003098273.1.83946 WP_003098273.1.84003 WP_003098273.1.84008 WP_003098273.1.84138 WP_003098273.1.84162 WP_003098273.1.84174 WP_003098273.1.84177 WP_003098273.1.84178 WP_003098273.1.84190 WP_003098273.1.84203 WP_003098273.1.84271 WP_003098273.1.84297 WP_003098273.1.8437 WP_003098273.1.84374 WP_003098273.1.84398 WP_003098273.1.84404 WP_003098273.1.84439 WP_003098273.1.84471 WP_003098273.1.84526 WP_003098273.1.8453 WP_003098273.1.84538 WP_003098273.1.84558 WP_003098273.1.84674 WP_003098273.1.84684 WP_003098273.1.84702 WP_003098273.1.84715 WP_003098273.1.84754 WP_003098273.1.84792 WP_003098273.1.8484 WP_003098273.1.84865 WP_003098273.1.84917 WP_003098273.1.84937 WP_003098273.1.84946 WP_003098273.1.8498 WP_003098273.1.85018 WP_003098273.1.85028 WP_003098273.1.85059 WP_003098273.1.85150 WP_003098273.1.85220 WP_003098273.1.85290 WP_003098273.1.85298 WP_003098273.1.85303 WP_003098273.1.85311 WP_003098273.1.85318 WP_003098273.1.85357 WP_003098273.1.85446 WP_003098273.1.85453 WP_003098273.1.85574 WP_003098273.1.85633 WP_003098273.1.85638 WP_003098273.1.85788 WP_003098273.1.85897 WP_003098273.1.85920 WP_003098273.1.86002 WP_003098273.1.86047 WP_003098273.1.86055 WP_003098273.1.86058 WP_003098273.1.861 WP_003098273.1.86125 WP_003098273.1.86182 WP_003098273.1.86278 WP_003098273.1.86287 WP_003098273.1.86293 WP_003098273.1.86386 WP_003098273.1.86432 WP_003098273.1.865 WP_003098273.1.86545 WP_003098273.1.86552 WP_003098273.1.86554 WP_003098273.1.86652 WP_003098273.1.86660 WP_003098273.1.86665 WP_003098273.1.867 WP_003098273.1.86708 WP_003098273.1.86733 WP_003098273.1.86774 WP_003098273.1.86780 WP_003098273.1.86785 WP_003098273.1.86796 WP_003098273.1.86813 WP_003098273.1.86822 WP_003098273.1.8693 WP_003098273.1.86970 WP_003098273.1.86985 WP_003098273.1.87104 WP_003098273.1.87163 WP_003098273.1.8718 WP_003098273.1.87182 WP_003098273.1.87183 WP_003098273.1.8727 WP_003098273.1.87390 WP_003098273.1.87435 WP_003098273.1.87463 WP_003098273.1.8749 WP_003098273.1.87530 WP_003098273.1.87547 WP_003098273.1.87648 WP_003098273.1.87763 WP_003098273.1.8777 WP_003098273.1.8785 WP_003098273.1.87877 WP_003098273.1.87888 WP_003098273.1.87970 WP_003098273.1.87987 WP_003098273.1.88004 WP_003098273.1.88152 WP_003098273.1.88308 WP_003098273.1.88330 WP_003098273.1.88360 WP_003098273.1.88415 WP_003098273.1.88517 WP_003098273.1.8852 WP_003098273.1.88540 WP_003098273.1.88550 WP_003098273.1.88578 WP_003098273.1.88605 WP_003098273.1.88679 WP_003098273.1.88680 WP_003098273.1.88714 WP_003098273.1.88750 WP_003098273.1.88796 WP_003098273.1.889 WP_003098273.1.88900 WP_003098273.1.88949 WP_003098273.1.88969 WP_003098273.1.89083 WP_003098273.1.89098 WP_003098273.1.8911 WP_003098273.1.89234 WP_003098273.1.89266 WP_003098273.1.89276 WP_003098273.1.89330 WP_003098273.1.89409 WP_003098273.1.89434 WP_003098273.1.89440 WP_003098273.1.89480 WP_003098273.1.8949 WP_003098273.1.89491 WP_003098273.1.89523 WP_003098273.1.89577 WP_003098273.1.89610 WP_003098273.1.89638 WP_003098273.1.89662 WP_003098273.1.89669 WP_003098273.1.89736 WP_003098273.1.8976 WP_003098273.1.89776 WP_003098273.1.89805 WP_003098273.1.89866 WP_003098273.1.89867 WP_003098273.1.89871 WP_003098273.1.89886 WP_003098273.1.89992 WP_003098273.1.90024 WP_003098273.1.90032 WP_003098273.1.90056 WP_003098273.1.90110 WP_003098273.1.90141 WP_003098273.1.90150 WP_003098273.1.90189 WP_003098273.1.90224 WP_003098273.1.90225 WP_003098273.1.90242 WP_003098273.1.90268 WP_003098273.1.90306 WP_003098273.1.90412 WP_003098273.1.9056 WP_003098273.1.90569 WP_003098273.1.90655 WP_003098273.1.90770 WP_003098273.1.90922 WP_003098273.1.90940 WP_003098273.1.90999 WP_003098273.1.91093 WP_003098273.1.91161 WP_003098273.1.9120 WP_003098273.1.91204 WP_003098273.1.91281 WP_003098273.1.91307 WP_003098273.1.91336 WP_003098273.1.91360 WP_003098273.1.91392 WP_003098273.1.91416 WP_003098273.1.9143 WP_003098273.1.91431 WP_003098273.1.91438 WP_003098273.1.91467 WP_003098273.1.91527 WP_003098273.1.91563 WP_003098273.1.91585 WP_003098273.1.91796 WP_003098273.1.91803 WP_003098273.1.9182 WP_003098273.1.91838 WP_003098273.1.91846 WP_003098273.1.91860 WP_003098273.1.91862 WP_003098273.1.9191 WP_003098273.1.92043 WP_003098273.1.92175 WP_003098273.1.9219 WP_003098273.1.92314 WP_003098273.1.92321 WP_003098273.1.92357 WP_003098273.1.92454 WP_003098273.1.92573 WP_003098273.1.92585 WP_003098273.1.92587 WP_003098273.1.92589 WP_003098273.1.92594 WP_003098273.1.92624 WP_003098273.1.92630 WP_003098273.1.92642 WP_003098273.1.9272 WP_003098273.1.92759 WP_003098273.1.92769 WP_003098273.1.92839 WP_003098273.1.92847 WP_003098273.1.92924 WP_003098273.1.92930 WP_003098273.1.92974 WP_003098273.1.93090 WP_003098273.1.93122 WP_003098273.1.93144 WP_003098273.1.93148 WP_003098273.1.93250 WP_003098273.1.93264 WP_003098273.1.9328 WP_003098273.1.93446 WP_003098273.1.9349 WP_003098273.1.93493 WP_003098273.1.93498 WP_003098273.1.93547 WP_003098273.1.93562 WP_003098273.1.93568 WP_003098273.1.93797 WP_003098273.1.93848 WP_003098273.1.93889 WP_003098273.1.93897 WP_003098273.1.94004 WP_003098273.1.94031 WP_003098273.1.94065 WP_003098273.1.94078 WP_003098273.1.94136 WP_003098273.1.94174 WP_003098273.1.94211 WP_003098273.1.94218 WP_003098273.1.94230 WP_003098273.1.94243 WP_003098273.1.94285 WP_003098273.1.94333 WP_003098273.1.94349 WP_003098273.1.94385 WP_003098273.1.94422 WP_003098273.1.94434 WP_003098273.1.9444 WP_003098273.1.94682 WP_003098273.1.94732 WP_003098273.1.94742 WP_003098273.1.94814 WP_003098273.1.94818 WP_003098273.1.94856 WP_003098273.1.94874 WP_003098273.1.94896 WP_003098273.1.94897 WP_003098273.1.94943 WP_003098273.1.95018 WP_003098273.1.95025 WP_003098273.1.95027 WP_003098273.1.95056 WP_003098273.1.95117 WP_003098273.1.95187 WP_003098273.1.95207 WP_003098273.1.95217 WP_003098273.1.95305 WP_003098273.1.95324 WP_003098273.1.95354 WP_003098273.1.95359 WP_003098273.1.95460 WP_003098273.1.95488 WP_003098273.1.95525 WP_003098273.1.95536 WP_003098273.1.95638 WP_003098273.1.95668 WP_003098273.1.95745 WP_003098273.1.95751 WP_003098273.1.95774 WP_003098273.1.95782 WP_003098273.1.95787 WP_003098273.1.95802 WP_003098273.1.95820 WP_003098273.1.95825 WP_003098273.1.95959 WP_003098273.1.9599 WP_003098273.1.95994 WP_003098273.1.95999 WP_003098273.1.96008 WP_003098273.1.9604 WP_003098273.1.96041 WP_003098273.1.96058 WP_003098273.1.961 WP_003098273.1.96134 WP_003098273.1.96193 WP_003098273.1.96243 WP_003098273.1.96267 WP_003098273.1.96357 WP_003098273.1.96384 WP_003098273.1.96434 WP_003098273.1.96452 WP_003098273.1.96506 WP_003098273.1.96667 WP_003098273.1.96702 WP_003098273.1.96714 WP_003098273.1.96880 WP_003098273.1.96967 WP_003098273.1.9706 WP_003098273.1.97118 WP_003098273.1.97126 WP_003098273.1.97204 WP_003098273.1.97213 WP_003098273.1.9722 WP_003098273.1.97271 WP_003098273.1.97272 WP_003098273.1.97377 WP_003098273.1.97461 WP_003098273.1.97474 WP_003098273.1.97488 WP_003098273.1.97499 WP_003098273.1.97521 WP_003098273.1.97583 WP_003098273.1.97614 WP_003098273.1.977 WP_003098273.1.97877 WP_003098273.1.97968 WP_003098273.1.98111 WP_003098273.1.98260 WP_003098273.1.98308 WP_003098273.1.98410 WP_003098273.1.98414 WP_003098273.1.98433 WP_003098273.1.9845 WP_003098273.1.985 WP_003098273.1.98515 WP_003098273.1.98522 WP_003098273.1.98573 WP_003098273.1.98600 WP_003098273.1.98610 WP_003098273.1.98672 WP_003098273.1.98678 WP_003098273.1.98693 WP_003098273.1.98718 WP_003098273.1.98788 WP_003098273.1.98814 WP_003098273.1.9885 WP_003098273.1.98873 WP_003098273.1.98926 WP_003098273.1.98958 WP_003098273.1.98960 WP_003098273.1.98963 WP_003098273.1.99065 WP_003098273.1.99068 WP_003098273.1.99103 WP_003098273.1.99214 WP_003098273.1.99293 WP_003098273.1.99353 WP_003098273.1.99378 WP_003098273.1.99386 WP_003098273.1.99389 WP_003098273.1.99443 WP_003098273.1.9951 WP_003098273.1.99516 WP_003098273.1.99647 WP_003098273.1.99654 WP_003098273.1.99662 WP_003098273.1.99746 WP_003098273.1.99757 WP_003098273.1.99772 WP_003098273.1.99795 WP_003098273.1.99835 WP_003098273.1.99930 gi|514412410|ref|YP_008135962.1| gi|392987026|ref|YP_006485613.1| 208963.PA14_70010 208964.PA5303 381754.PSPA7_6077 557722.PLES_56981 gi|116053450|ref|YP_793777.1| gi|152985564|ref|YP_001351393.1| gi|568156833|ref|YP_008945826.1| gi|15600496|ref|NP_253990.1| gi|218894406|ref|YP_002443276.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]