SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|568156869|ref|YP_008945862.1| from Pseudomonas aeruginosa LES431

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|568156869|ref|YP_008945862.1|
Domain Number 1 Region: 1-125
Classification Level Classification E-value
Superfamily YjgF-like 3.93e-46
Family YjgF/L-PSP 0.0000308
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|568156869|ref|YP_008945862.1|
Sequence length 126
Comment endoribonuclease [Pseudomonas aeruginosa LES431]
Sequence
MTKTVIHTDNAPAAIGTYSQAIKAGNTVYVSGQIPLDPKTMELVEGFEEQTVQVFENLKA
VIEASGGYLHDVAKLNIFLTDLSHFAKVNEIMGRYFTQPYPARAAIGVAALPKGAQVEMD
AIVVLE
Download sequence
Identical sequences A0A069QB33 A0A0E1B6R2 A0A0H2ZI87 A0A0H3QJJ9 A0A157YZR9 A0A1E9C0Y1 A0A1F0I103 A0A1G5LXA5 A0A1S1BWF6 Q9HTL9 V6APW0 W1MVZ0
gi|386061516|ref|YP_005978038.1| gi|568156869|ref|YP_008945862.1| gi|568312792|ref|YP_008985061.1| NP_254026.1.87394 WP_003096609.1.100071 WP_003096609.1.100100 WP_003096609.1.100179 WP_003096609.1.100276 WP_003096609.1.100278 WP_003096609.1.100319 WP_003096609.1.100394 WP_003096609.1.100420 WP_003096609.1.100456 WP_003096609.1.100469 WP_003096609.1.100473 WP_003096609.1.100476 WP_003096609.1.100523 WP_003096609.1.100654 WP_003096609.1.100723 WP_003096609.1.100742 WP_003096609.1.100777 WP_003096609.1.100786 WP_003096609.1.100808 WP_003096609.1.100809 WP_003096609.1.100810 WP_003096609.1.100872 WP_003096609.1.100983 WP_003096609.1.100995 WP_003096609.1.101021 WP_003096609.1.101047 WP_003096609.1.101090 WP_003096609.1.101269 WP_003096609.1.101310 WP_003096609.1.101340 WP_003096609.1.101506 WP_003096609.1.101572 WP_003096609.1.101590 WP_003096609.1.101642 WP_003096609.1.101712 WP_003096609.1.101739 WP_003096609.1.10174 WP_003096609.1.101781 WP_003096609.1.10179 WP_003096609.1.101809 WP_003096609.1.101819 WP_003096609.1.10185 WP_003096609.1.101863 WP_003096609.1.101871 WP_003096609.1.10201 WP_003096609.1.10202 WP_003096609.1.10204 WP_003096609.1.102045 WP_003096609.1.10228 WP_003096609.1.10248 WP_003096609.1.10257 WP_003096609.1.10271 WP_003096609.1.1037 WP_003096609.1.10407 WP_003096609.1.10419 WP_003096609.1.10435 WP_003096609.1.10457 WP_003096609.1.10468 WP_003096609.1.10477 WP_003096609.1.10482 WP_003096609.1.10513 WP_003096609.1.10529 WP_003096609.1.10548 WP_003096609.1.10572 WP_003096609.1.10575 WP_003096609.1.10636 WP_003096609.1.10641 WP_003096609.1.10684 WP_003096609.1.10764 WP_003096609.1.10856 WP_003096609.1.10895 WP_003096609.1.10901 WP_003096609.1.10949 WP_003096609.1.11026 WP_003096609.1.11058 WP_003096609.1.1107 WP_003096609.1.11077 WP_003096609.1.1109 WP_003096609.1.11130 WP_003096609.1.11163 WP_003096609.1.11178 WP_003096609.1.11180 WP_003096609.1.11318 WP_003096609.1.11381 WP_003096609.1.11388 WP_003096609.1.11410 WP_003096609.1.11417 WP_003096609.1.11454 WP_003096609.1.11568 WP_003096609.1.11569 WP_003096609.1.11653 WP_003096609.1.11744 WP_003096609.1.11754 WP_003096609.1.1180 WP_003096609.1.1183 WP_003096609.1.11847 WP_003096609.1.1187 WP_003096609.1.11943 WP_003096609.1.12018 WP_003096609.1.12081 WP_003096609.1.12120 WP_003096609.1.12150 WP_003096609.1.12200 WP_003096609.1.12208 WP_003096609.1.12240 WP_003096609.1.12302 WP_003096609.1.12354 WP_003096609.1.1238 WP_003096609.1.12400 WP_003096609.1.12482 WP_003096609.1.12497 WP_003096609.1.12530 WP_003096609.1.12547 WP_003096609.1.12561 WP_003096609.1.12657 WP_003096609.1.12660 WP_003096609.1.12670 WP_003096609.1.12687 WP_003096609.1.12744 WP_003096609.1.12797 WP_003096609.1.12838 WP_003096609.1.12873 WP_003096609.1.12890 WP_003096609.1.12891 WP_003096609.1.12922 WP_003096609.1.12930 WP_003096609.1.12934 WP_003096609.1.12970 WP_003096609.1.12980 WP_003096609.1.13 WP_003096609.1.13041 WP_003096609.1.1305 WP_003096609.1.13057 WP_003096609.1.13077 WP_003096609.1.13085 WP_003096609.1.13092 WP_003096609.1.13208 WP_003096609.1.13232 WP_003096609.1.13242 WP_003096609.1.13266 WP_003096609.1.13270 WP_003096609.1.13315 WP_003096609.1.1333 WP_003096609.1.13364 WP_003096609.1.13407 WP_003096609.1.13529 WP_003096609.1.13533 WP_003096609.1.1356 WP_003096609.1.1362 WP_003096609.1.13622 WP_003096609.1.13642 WP_003096609.1.13718 WP_003096609.1.13743 WP_003096609.1.13758 WP_003096609.1.13765 WP_003096609.1.13785 WP_003096609.1.13795 WP_003096609.1.13828 WP_003096609.1.13865 WP_003096609.1.1393 WP_003096609.1.14049 WP_003096609.1.14078 WP_003096609.1.14096 WP_003096609.1.14116 WP_003096609.1.14204 WP_003096609.1.14251 WP_003096609.1.14378 WP_003096609.1.14424 WP_003096609.1.14455 WP_003096609.1.14460 WP_003096609.1.14463 WP_003096609.1.14476 WP_003096609.1.14525 WP_003096609.1.14564 WP_003096609.1.14615 WP_003096609.1.14640 WP_003096609.1.14679 WP_003096609.1.14690 WP_003096609.1.14714 WP_003096609.1.1475 WP_003096609.1.14754 WP_003096609.1.14797 WP_003096609.1.14815 WP_003096609.1.14820 WP_003096609.1.14835 WP_003096609.1.14839 WP_003096609.1.14883 WP_003096609.1.14966 WP_003096609.1.14981 WP_003096609.1.15004 WP_003096609.1.15130 WP_003096609.1.1516 WP_003096609.1.152 WP_003096609.1.15222 WP_003096609.1.15231 WP_003096609.1.15281 WP_003096609.1.15297 WP_003096609.1.15328 WP_003096609.1.15373 WP_003096609.1.15379 WP_003096609.1.15408 WP_003096609.1.15474 WP_003096609.1.15480 WP_003096609.1.15482 WP_003096609.1.15485 WP_003096609.1.15602 WP_003096609.1.15666 WP_003096609.1.15692 WP_003096609.1.15886 WP_003096609.1.15889 WP_003096609.1.15934 WP_003096609.1.16041 WP_003096609.1.16074 WP_003096609.1.16109 WP_003096609.1.16142 WP_003096609.1.16161 WP_003096609.1.16197 WP_003096609.1.162 WP_003096609.1.16239 WP_003096609.1.16242 WP_003096609.1.16267 WP_003096609.1.16279 WP_003096609.1.16419 WP_003096609.1.1646 WP_003096609.1.16660 WP_003096609.1.16694 WP_003096609.1.1670 WP_003096609.1.1671 WP_003096609.1.16751 WP_003096609.1.16782 WP_003096609.1.16788 WP_003096609.1.16801 WP_003096609.1.16808 WP_003096609.1.16811 WP_003096609.1.16895 WP_003096609.1.17022 WP_003096609.1.1704 WP_003096609.1.17108 WP_003096609.1.17155 WP_003096609.1.17162 WP_003096609.1.17177 WP_003096609.1.17189 WP_003096609.1.17223 WP_003096609.1.17353 WP_003096609.1.17354 WP_003096609.1.17370 WP_003096609.1.1739 WP_003096609.1.17397 WP_003096609.1.17499 WP_003096609.1.17566 WP_003096609.1.1758 WP_003096609.1.1761 WP_003096609.1.17697 WP_003096609.1.17883 WP_003096609.1.17890 WP_003096609.1.18052 WP_003096609.1.18054 WP_003096609.1.18117 WP_003096609.1.18156 WP_003096609.1.18157 WP_003096609.1.18199 WP_003096609.1.18204 WP_003096609.1.18234 WP_003096609.1.1824 WP_003096609.1.18349 WP_003096609.1.18440 WP_003096609.1.18493 WP_003096609.1.18508 WP_003096609.1.18547 WP_003096609.1.18653 WP_003096609.1.18728 WP_003096609.1.18732 WP_003096609.1.18735 WP_003096609.1.18769 WP_003096609.1.18795 WP_003096609.1.18852 WP_003096609.1.18892 WP_003096609.1.18907 WP_003096609.1.18911 WP_003096609.1.18930 WP_003096609.1.190 WP_003096609.1.19089 WP_003096609.1.19199 WP_003096609.1.19251 WP_003096609.1.19260 WP_003096609.1.19269 WP_003096609.1.19346 WP_003096609.1.19351 WP_003096609.1.19376 WP_003096609.1.1938 WP_003096609.1.19552 WP_003096609.1.19591 WP_003096609.1.19640 WP_003096609.1.19703 WP_003096609.1.1971 WP_003096609.1.19711 WP_003096609.1.19718 WP_003096609.1.19741 WP_003096609.1.19771 WP_003096609.1.19803 WP_003096609.1.19824 WP_003096609.1.19930 WP_003096609.1.19931 WP_003096609.1.20024 WP_003096609.1.20070 WP_003096609.1.2012 WP_003096609.1.20125 WP_003096609.1.20134 WP_003096609.1.20216 WP_003096609.1.20342 WP_003096609.1.20590 WP_003096609.1.20682 WP_003096609.1.20692 WP_003096609.1.20744 WP_003096609.1.20764 WP_003096609.1.20825 WP_003096609.1.20854 WP_003096609.1.20880 WP_003096609.1.20884 WP_003096609.1.20890 WP_003096609.1.209 WP_003096609.1.20929 WP_003096609.1.20978 WP_003096609.1.21002 WP_003096609.1.21039 WP_003096609.1.21096 WP_003096609.1.21100 WP_003096609.1.21166 WP_003096609.1.21209 WP_003096609.1.21242 WP_003096609.1.21253 WP_003096609.1.21302 WP_003096609.1.21349 WP_003096609.1.21358 WP_003096609.1.2144 WP_003096609.1.21448 WP_003096609.1.21460 WP_003096609.1.21469 WP_003096609.1.21471 WP_003096609.1.21517 WP_003096609.1.21607 WP_003096609.1.21718 WP_003096609.1.2172 WP_003096609.1.21744 WP_003096609.1.21767 WP_003096609.1.21782 WP_003096609.1.21801 WP_003096609.1.21863 WP_003096609.1.21871 WP_003096609.1.21891 WP_003096609.1.21932 WP_003096609.1.22078 WP_003096609.1.221 WP_003096609.1.2228 WP_003096609.1.22324 WP_003096609.1.22365 WP_003096609.1.2237 WP_003096609.1.22389 WP_003096609.1.22390 WP_003096609.1.22394 WP_003096609.1.22442 WP_003096609.1.22477 WP_003096609.1.22491 WP_003096609.1.22573 WP_003096609.1.22671 WP_003096609.1.22704 WP_003096609.1.22729 WP_003096609.1.22863 WP_003096609.1.2289 WP_003096609.1.22891 WP_003096609.1.23013 WP_003096609.1.23166 WP_003096609.1.23191 WP_003096609.1.23195 WP_003096609.1.2323 WP_003096609.1.23264 WP_003096609.1.23331 WP_003096609.1.23394 WP_003096609.1.23418 WP_003096609.1.23421 WP_003096609.1.23512 WP_003096609.1.23518 WP_003096609.1.23523 WP_003096609.1.23525 WP_003096609.1.2355 WP_003096609.1.23559 WP_003096609.1.23581 WP_003096609.1.236 WP_003096609.1.23611 WP_003096609.1.23641 WP_003096609.1.23715 WP_003096609.1.23739 WP_003096609.1.2374 WP_003096609.1.23769 WP_003096609.1.23782 WP_003096609.1.23794 WP_003096609.1.23884 WP_003096609.1.23925 WP_003096609.1.23938 WP_003096609.1.23961 WP_003096609.1.23967 WP_003096609.1.23983 WP_003096609.1.24066 WP_003096609.1.24077 WP_003096609.1.24087 WP_003096609.1.24101 WP_003096609.1.24183 WP_003096609.1.24234 WP_003096609.1.24319 WP_003096609.1.24351 WP_003096609.1.24382 WP_003096609.1.24413 WP_003096609.1.24447 WP_003096609.1.2453 WP_003096609.1.24626 WP_003096609.1.24662 WP_003096609.1.2477 WP_003096609.1.24851 WP_003096609.1.24862 WP_003096609.1.24869 WP_003096609.1.24879 WP_003096609.1.24938 WP_003096609.1.24940 WP_003096609.1.25033 WP_003096609.1.25052 WP_003096609.1.25067 WP_003096609.1.25075 WP_003096609.1.251 WP_003096609.1.25109 WP_003096609.1.2511 WP_003096609.1.25142 WP_003096609.1.25149 WP_003096609.1.25179 WP_003096609.1.25191 WP_003096609.1.25271 WP_003096609.1.2529 WP_003096609.1.2530 WP_003096609.1.25328 WP_003096609.1.25344 WP_003096609.1.25348 WP_003096609.1.2535 WP_003096609.1.25477 WP_003096609.1.25532 WP_003096609.1.25600 WP_003096609.1.25641 WP_003096609.1.25695 WP_003096609.1.2572 WP_003096609.1.25834 WP_003096609.1.25903 WP_003096609.1.2596 WP_003096609.1.25964 WP_003096609.1.26010 WP_003096609.1.26025 WP_003096609.1.26042 WP_003096609.1.261 WP_003096609.1.26159 WP_003096609.1.26301 WP_003096609.1.26334 WP_003096609.1.26428 WP_003096609.1.26463 WP_003096609.1.26473 WP_003096609.1.26489 WP_003096609.1.2652 WP_003096609.1.26539 WP_003096609.1.26553 WP_003096609.1.26592 WP_003096609.1.26604 WP_003096609.1.26681 WP_003096609.1.26682 WP_003096609.1.26705 WP_003096609.1.26740 WP_003096609.1.26816 WP_003096609.1.26841 WP_003096609.1.26862 WP_003096609.1.26906 WP_003096609.1.26967 WP_003096609.1.2698 WP_003096609.1.27018 WP_003096609.1.27028 WP_003096609.1.27073 WP_003096609.1.27107 WP_003096609.1.27211 WP_003096609.1.27218 WP_003096609.1.27259 WP_003096609.1.27288 WP_003096609.1.27534 WP_003096609.1.27549 WP_003096609.1.27575 WP_003096609.1.27587 WP_003096609.1.27687 WP_003096609.1.27738 WP_003096609.1.27783 WP_003096609.1.27825 WP_003096609.1.27837 WP_003096609.1.27858 WP_003096609.1.27933 WP_003096609.1.27939 WP_003096609.1.27966 WP_003096609.1.28006 WP_003096609.1.28057 WP_003096609.1.28064 WP_003096609.1.28078 WP_003096609.1.28136 WP_003096609.1.28175 WP_003096609.1.28193 WP_003096609.1.28258 WP_003096609.1.283 WP_003096609.1.28316 WP_003096609.1.28329 WP_003096609.1.28372 WP_003096609.1.28382 WP_003096609.1.28383 WP_003096609.1.28404 WP_003096609.1.28468 WP_003096609.1.28528 WP_003096609.1.28560 WP_003096609.1.28602 WP_003096609.1.28623 WP_003096609.1.28699 WP_003096609.1.28713 WP_003096609.1.28757 WP_003096609.1.28800 WP_003096609.1.28823 WP_003096609.1.28838 WP_003096609.1.28849 WP_003096609.1.28878 WP_003096609.1.28920 WP_003096609.1.29003 WP_003096609.1.29008 WP_003096609.1.29062 WP_003096609.1.29070 WP_003096609.1.29096 WP_003096609.1.29127 WP_003096609.1.29137 WP_003096609.1.29158 WP_003096609.1.29179 WP_003096609.1.29208 WP_003096609.1.2927 WP_003096609.1.29401 WP_003096609.1.2941 WP_003096609.1.29438 WP_003096609.1.29440 WP_003096609.1.29472 WP_003096609.1.2948 WP_003096609.1.29481 WP_003096609.1.29498 WP_003096609.1.29501 WP_003096609.1.29577 WP_003096609.1.2961 WP_003096609.1.29633 WP_003096609.1.29650 WP_003096609.1.29668 WP_003096609.1.29753 WP_003096609.1.29767 WP_003096609.1.2980 WP_003096609.1.29848 WP_003096609.1.29920 WP_003096609.1.29958 WP_003096609.1.29973 WP_003096609.1.30000 WP_003096609.1.30020 WP_003096609.1.30081 WP_003096609.1.30120 WP_003096609.1.30254 WP_003096609.1.3030 WP_003096609.1.30365 WP_003096609.1.30474 WP_003096609.1.30475 WP_003096609.1.30563 WP_003096609.1.30567 WP_003096609.1.30614 WP_003096609.1.30615 WP_003096609.1.30625 WP_003096609.1.30693 WP_003096609.1.30707 WP_003096609.1.3072 WP_003096609.1.30797 WP_003096609.1.30810 WP_003096609.1.30815 WP_003096609.1.30842 WP_003096609.1.30886 WP_003096609.1.30943 WP_003096609.1.30973 WP_003096609.1.30994 WP_003096609.1.31045 WP_003096609.1.31076 WP_003096609.1.31087 WP_003096609.1.31103 WP_003096609.1.31105 WP_003096609.1.31138 WP_003096609.1.31147 WP_003096609.1.31279 WP_003096609.1.31361 WP_003096609.1.31457 WP_003096609.1.31501 WP_003096609.1.31563 WP_003096609.1.31565 WP_003096609.1.31587 WP_003096609.1.31633 WP_003096609.1.31655 WP_003096609.1.3172 WP_003096609.1.31732 WP_003096609.1.31741 WP_003096609.1.31751 WP_003096609.1.3179 WP_003096609.1.31848 WP_003096609.1.31852 WP_003096609.1.3189 WP_003096609.1.319 WP_003096609.1.31939 WP_003096609.1.32134 WP_003096609.1.32137 WP_003096609.1.32144 WP_003096609.1.32235 WP_003096609.1.32289 WP_003096609.1.32314 WP_003096609.1.32359 WP_003096609.1.32447 WP_003096609.1.32523 WP_003096609.1.32544 WP_003096609.1.32596 WP_003096609.1.32626 WP_003096609.1.32637 WP_003096609.1.32641 WP_003096609.1.32711 WP_003096609.1.32821 WP_003096609.1.32869 WP_003096609.1.32879 WP_003096609.1.32998 WP_003096609.1.33009 WP_003096609.1.33047 WP_003096609.1.33097 WP_003096609.1.33133 WP_003096609.1.33152 WP_003096609.1.33186 WP_003096609.1.33204 WP_003096609.1.33210 WP_003096609.1.33216 WP_003096609.1.33294 WP_003096609.1.33340 WP_003096609.1.33387 WP_003096609.1.33438 WP_003096609.1.33441 WP_003096609.1.33455 WP_003096609.1.3351 WP_003096609.1.33517 WP_003096609.1.33521 WP_003096609.1.33523 WP_003096609.1.33547 WP_003096609.1.33549 WP_003096609.1.33653 WP_003096609.1.33658 WP_003096609.1.33669 WP_003096609.1.3368 WP_003096609.1.33728 WP_003096609.1.33733 WP_003096609.1.33734 WP_003096609.1.3376 WP_003096609.1.33774 WP_003096609.1.33801 WP_003096609.1.33814 WP_003096609.1.33822 WP_003096609.1.33824 WP_003096609.1.33833 WP_003096609.1.3385 WP_003096609.1.33945 WP_003096609.1.34000 WP_003096609.1.34039 WP_003096609.1.34136 WP_003096609.1.34150 WP_003096609.1.34151 WP_003096609.1.34180 WP_003096609.1.34191 WP_003096609.1.34203 WP_003096609.1.34306 WP_003096609.1.34317 WP_003096609.1.34324 WP_003096609.1.3436 WP_003096609.1.34401 WP_003096609.1.34402 WP_003096609.1.34461 WP_003096609.1.34465 WP_003096609.1.34472 WP_003096609.1.3452 WP_003096609.1.34556 WP_003096609.1.34568 WP_003096609.1.34583 WP_003096609.1.34625 WP_003096609.1.34670 WP_003096609.1.34689 WP_003096609.1.34731 WP_003096609.1.34784 WP_003096609.1.34821 WP_003096609.1.34832 WP_003096609.1.34836 WP_003096609.1.34837 WP_003096609.1.34876 WP_003096609.1.34878 WP_003096609.1.34901 WP_003096609.1.34922 WP_003096609.1.34942 WP_003096609.1.35036 WP_003096609.1.35104 WP_003096609.1.35149 WP_003096609.1.35231 WP_003096609.1.35281 WP_003096609.1.3531 WP_003096609.1.35325 WP_003096609.1.35353 WP_003096609.1.3540 WP_003096609.1.35431 WP_003096609.1.35442 WP_003096609.1.35480 WP_003096609.1.35512 WP_003096609.1.35529 WP_003096609.1.3555 WP_003096609.1.35573 WP_003096609.1.35599 WP_003096609.1.35639 WP_003096609.1.35641 WP_003096609.1.35669 WP_003096609.1.35679 WP_003096609.1.3568 WP_003096609.1.35682 WP_003096609.1.3576 WP_003096609.1.35762 WP_003096609.1.35768 WP_003096609.1.35822 WP_003096609.1.35843 WP_003096609.1.35857 WP_003096609.1.35872 WP_003096609.1.35968 WP_003096609.1.35984 WP_003096609.1.36064 WP_003096609.1.36121 WP_003096609.1.36148 WP_003096609.1.36170 WP_003096609.1.36266 WP_003096609.1.36267 WP_003096609.1.36285 WP_003096609.1.36378 WP_003096609.1.36435 WP_003096609.1.36487 WP_003096609.1.36521 WP_003096609.1.3653 WP_003096609.1.36587 WP_003096609.1.36608 WP_003096609.1.3662 WP_003096609.1.36630 WP_003096609.1.36665 WP_003096609.1.36708 WP_003096609.1.3672 WP_003096609.1.36756 WP_003096609.1.36781 WP_003096609.1.36879 WP_003096609.1.37050 WP_003096609.1.37097 WP_003096609.1.37125 WP_003096609.1.37163 WP_003096609.1.37172 WP_003096609.1.37208 WP_003096609.1.3721 WP_003096609.1.37216 WP_003096609.1.373 WP_003096609.1.37319 WP_003096609.1.37366 WP_003096609.1.37416 WP_003096609.1.3742 WP_003096609.1.37500 WP_003096609.1.37512 WP_003096609.1.37571 WP_003096609.1.3768 WP_003096609.1.37698 WP_003096609.1.37703 WP_003096609.1.3773 WP_003096609.1.37799 WP_003096609.1.3781 WP_003096609.1.37814 WP_003096609.1.37818 WP_003096609.1.37826 WP_003096609.1.37842 WP_003096609.1.3785 WP_003096609.1.3792 WP_003096609.1.38003 WP_003096609.1.38023 WP_003096609.1.38060 WP_003096609.1.38087 WP_003096609.1.38102 WP_003096609.1.38146 WP_003096609.1.38151 WP_003096609.1.3818 WP_003096609.1.38186 WP_003096609.1.3821 WP_003096609.1.38319 WP_003096609.1.3833 WP_003096609.1.38335 WP_003096609.1.38337 WP_003096609.1.38406 WP_003096609.1.38430 WP_003096609.1.38450 WP_003096609.1.38502 WP_003096609.1.38505 WP_003096609.1.38510 WP_003096609.1.38582 WP_003096609.1.38583 WP_003096609.1.38587 WP_003096609.1.38657 WP_003096609.1.38661 WP_003096609.1.3870 WP_003096609.1.38706 WP_003096609.1.38727 WP_003096609.1.38816 WP_003096609.1.38834 WP_003096609.1.38889 WP_003096609.1.38932 WP_003096609.1.38971 WP_003096609.1.39046 WP_003096609.1.39088 WP_003096609.1.39122 WP_003096609.1.39186 WP_003096609.1.39271 WP_003096609.1.39326 WP_003096609.1.39345 WP_003096609.1.3943 WP_003096609.1.39444 WP_003096609.1.39452 WP_003096609.1.39458 WP_003096609.1.39704 WP_003096609.1.39765 WP_003096609.1.39786 WP_003096609.1.39811 WP_003096609.1.39920 WP_003096609.1.39949 WP_003096609.1.3998 WP_003096609.1.39989 WP_003096609.1.40059 WP_003096609.1.40115 WP_003096609.1.40135 WP_003096609.1.40207 WP_003096609.1.40213 WP_003096609.1.40237 WP_003096609.1.40243 WP_003096609.1.40271 WP_003096609.1.4038 WP_003096609.1.40419 WP_003096609.1.40442 WP_003096609.1.40512 WP_003096609.1.40513 WP_003096609.1.40541 WP_003096609.1.40546 WP_003096609.1.4058 WP_003096609.1.40595 WP_003096609.1.40703 WP_003096609.1.40874 WP_003096609.1.40950 WP_003096609.1.40984 WP_003096609.1.40993 WP_003096609.1.40994 WP_003096609.1.41110 WP_003096609.1.41137 WP_003096609.1.41199 WP_003096609.1.41290 WP_003096609.1.41291 WP_003096609.1.41301 WP_003096609.1.41384 WP_003096609.1.41412 WP_003096609.1.41429 WP_003096609.1.41487 WP_003096609.1.41492 WP_003096609.1.41502 WP_003096609.1.4156 WP_003096609.1.41618 WP_003096609.1.41624 WP_003096609.1.41625 WP_003096609.1.41692 WP_003096609.1.41703 WP_003096609.1.41725 WP_003096609.1.41732 WP_003096609.1.41748 WP_003096609.1.41773 WP_003096609.1.41832 WP_003096609.1.41846 WP_003096609.1.41871 WP_003096609.1.41888 WP_003096609.1.4190 WP_003096609.1.41939 WP_003096609.1.4196 WP_003096609.1.42 WP_003096609.1.42019 WP_003096609.1.42041 WP_003096609.1.42047 WP_003096609.1.42146 WP_003096609.1.42259 WP_003096609.1.42294 WP_003096609.1.42316 WP_003096609.1.42381 WP_003096609.1.42388 WP_003096609.1.42411 WP_003096609.1.42423 WP_003096609.1.42463 WP_003096609.1.42499 WP_003096609.1.42508 WP_003096609.1.42634 WP_003096609.1.42643 WP_003096609.1.42690 WP_003096609.1.42696 WP_003096609.1.42723 WP_003096609.1.4273 WP_003096609.1.42754 WP_003096609.1.42757 WP_003096609.1.42778 WP_003096609.1.42789 WP_003096609.1.42854 WP_003096609.1.42856 WP_003096609.1.42870 WP_003096609.1.42917 WP_003096609.1.42946 WP_003096609.1.42952 WP_003096609.1.42972 WP_003096609.1.42973 WP_003096609.1.43022 WP_003096609.1.43024 WP_003096609.1.43026 WP_003096609.1.43049 WP_003096609.1.43106 WP_003096609.1.43107 WP_003096609.1.43212 WP_003096609.1.43245 WP_003096609.1.43286 WP_003096609.1.43293 WP_003096609.1.43315 WP_003096609.1.43326 WP_003096609.1.43330 WP_003096609.1.43356 WP_003096609.1.4348 WP_003096609.1.43593 WP_003096609.1.43603 WP_003096609.1.43662 WP_003096609.1.43667 WP_003096609.1.43673 WP_003096609.1.43696 WP_003096609.1.43729 WP_003096609.1.43756 WP_003096609.1.43783 WP_003096609.1.43802 WP_003096609.1.4381 WP_003096609.1.43811 WP_003096609.1.43826 WP_003096609.1.4397 WP_003096609.1.4398 WP_003096609.1.43998 WP_003096609.1.44046 WP_003096609.1.44094 WP_003096609.1.44213 WP_003096609.1.44260 WP_003096609.1.44269 WP_003096609.1.44373 WP_003096609.1.44434 WP_003096609.1.44486 WP_003096609.1.445 WP_003096609.1.44552 WP_003096609.1.44563 WP_003096609.1.44581 WP_003096609.1.44725 WP_003096609.1.44739 WP_003096609.1.44760 WP_003096609.1.44804 WP_003096609.1.44870 WP_003096609.1.4493 WP_003096609.1.44959 WP_003096609.1.45063 WP_003096609.1.45090 WP_003096609.1.45146 WP_003096609.1.45199 WP_003096609.1.45202 WP_003096609.1.4522 WP_003096609.1.45228 WP_003096609.1.45298 WP_003096609.1.45306 WP_003096609.1.45312 WP_003096609.1.4532 WP_003096609.1.45328 WP_003096609.1.45353 WP_003096609.1.45358 WP_003096609.1.45464 WP_003096609.1.45478 WP_003096609.1.45485 WP_003096609.1.45604 WP_003096609.1.45611 WP_003096609.1.45635 WP_003096609.1.45636 WP_003096609.1.45678 WP_003096609.1.45700 WP_003096609.1.45711 WP_003096609.1.45723 WP_003096609.1.45818 WP_003096609.1.45837 WP_003096609.1.45920 WP_003096609.1.45934 WP_003096609.1.45946 WP_003096609.1.45961 WP_003096609.1.46010 WP_003096609.1.46032 WP_003096609.1.46093 WP_003096609.1.461 WP_003096609.1.46152 WP_003096609.1.46200 WP_003096609.1.46306 WP_003096609.1.4640 WP_003096609.1.46436 WP_003096609.1.46502 WP_003096609.1.46623 WP_003096609.1.46633 WP_003096609.1.46755 WP_003096609.1.46787 WP_003096609.1.46826 WP_003096609.1.46846 WP_003096609.1.46866 WP_003096609.1.46885 WP_003096609.1.46926 WP_003096609.1.46935 WP_003096609.1.4699 WP_003096609.1.47101 WP_003096609.1.47150 WP_003096609.1.47155 WP_003096609.1.47158 WP_003096609.1.47251 WP_003096609.1.4726 WP_003096609.1.47296 WP_003096609.1.47312 WP_003096609.1.47314 WP_003096609.1.47374 WP_003096609.1.47469 WP_003096609.1.47480 WP_003096609.1.47527 WP_003096609.1.47551 WP_003096609.1.47598 WP_003096609.1.47645 WP_003096609.1.47774 WP_003096609.1.47930 WP_003096609.1.47934 WP_003096609.1.48001 WP_003096609.1.48024 WP_003096609.1.48086 WP_003096609.1.48094 WP_003096609.1.48141 WP_003096609.1.48172 WP_003096609.1.48178 WP_003096609.1.48321 WP_003096609.1.48334 WP_003096609.1.4836 WP_003096609.1.48378 WP_003096609.1.48382 WP_003096609.1.48413 WP_003096609.1.48472 WP_003096609.1.48474 WP_003096609.1.48487 WP_003096609.1.48545 WP_003096609.1.48546 WP_003096609.1.48576 WP_003096609.1.48579 WP_003096609.1.48747 WP_003096609.1.48810 WP_003096609.1.48820 WP_003096609.1.48840 WP_003096609.1.48842 WP_003096609.1.48851 WP_003096609.1.48870 WP_003096609.1.48961 WP_003096609.1.49108 WP_003096609.1.4913 WP_003096609.1.49135 WP_003096609.1.49244 WP_003096609.1.49265 WP_003096609.1.49266 WP_003096609.1.49277 WP_003096609.1.49286 WP_003096609.1.49293 WP_003096609.1.49360 WP_003096609.1.49416 WP_003096609.1.49500 WP_003096609.1.49557 WP_003096609.1.49566 WP_003096609.1.49688 WP_003096609.1.49798 WP_003096609.1.49806 WP_003096609.1.49833 WP_003096609.1.49842 WP_003096609.1.49922 WP_003096609.1.49948 WP_003096609.1.49976 WP_003096609.1.49988 WP_003096609.1.49998 WP_003096609.1.50176 WP_003096609.1.50180 WP_003096609.1.50222 WP_003096609.1.50232 WP_003096609.1.50242 WP_003096609.1.5043 WP_003096609.1.50450 WP_003096609.1.50459 WP_003096609.1.50567 WP_003096609.1.50653 WP_003096609.1.50665 WP_003096609.1.50668 WP_003096609.1.50682 WP_003096609.1.50691 WP_003096609.1.50734 WP_003096609.1.50783 WP_003096609.1.50814 WP_003096609.1.50922 WP_003096609.1.50967 WP_003096609.1.50989 WP_003096609.1.51019 WP_003096609.1.51035 WP_003096609.1.51136 WP_003096609.1.51141 WP_003096609.1.51173 WP_003096609.1.51183 WP_003096609.1.51185 WP_003096609.1.51267 WP_003096609.1.51273 WP_003096609.1.5132 WP_003096609.1.51457 WP_003096609.1.51472 WP_003096609.1.51501 WP_003096609.1.51538 WP_003096609.1.51549 WP_003096609.1.51585 WP_003096609.1.51682 WP_003096609.1.51727 WP_003096609.1.51807 WP_003096609.1.51847 WP_003096609.1.51889 WP_003096609.1.51928 WP_003096609.1.51937 WP_003096609.1.51943 WP_003096609.1.51957 WP_003096609.1.51976 WP_003096609.1.52043 WP_003096609.1.52146 WP_003096609.1.52152 WP_003096609.1.52212 WP_003096609.1.52220 WP_003096609.1.52244 WP_003096609.1.5226 WP_003096609.1.52326 WP_003096609.1.52334 WP_003096609.1.5235 WP_003096609.1.52355 WP_003096609.1.52372 WP_003096609.1.52403 WP_003096609.1.52449 WP_003096609.1.52500 WP_003096609.1.52537 WP_003096609.1.5258 WP_003096609.1.52583 WP_003096609.1.52591 WP_003096609.1.5260 WP_003096609.1.52690 WP_003096609.1.52697 WP_003096609.1.52700 WP_003096609.1.52728 WP_003096609.1.52784 WP_003096609.1.52790 WP_003096609.1.52810 WP_003096609.1.52850 WP_003096609.1.5289 WP_003096609.1.52939 WP_003096609.1.5294 WP_003096609.1.53037 WP_003096609.1.53038 WP_003096609.1.53070 WP_003096609.1.53072 WP_003096609.1.53169 WP_003096609.1.53267 WP_003096609.1.53287 WP_003096609.1.53351 WP_003096609.1.53371 WP_003096609.1.53414 WP_003096609.1.53427 WP_003096609.1.53486 WP_003096609.1.53528 WP_003096609.1.53530 WP_003096609.1.53586 WP_003096609.1.53663 WP_003096609.1.53678 WP_003096609.1.53719 WP_003096609.1.53726 WP_003096609.1.53826 WP_003096609.1.5388 WP_003096609.1.53932 WP_003096609.1.53946 WP_003096609.1.53948 WP_003096609.1.53951 WP_003096609.1.54003 WP_003096609.1.54076 WP_003096609.1.54078 WP_003096609.1.54090 WP_003096609.1.54133 WP_003096609.1.54140 WP_003096609.1.54146 WP_003096609.1.5420 WP_003096609.1.54248 WP_003096609.1.5427 WP_003096609.1.54293 WP_003096609.1.54354 WP_003096609.1.54362 WP_003096609.1.54462 WP_003096609.1.54497 WP_003096609.1.54571 WP_003096609.1.54742 WP_003096609.1.54809 WP_003096609.1.54974 WP_003096609.1.55 WP_003096609.1.55089 WP_003096609.1.55169 WP_003096609.1.55318 WP_003096609.1.55347 WP_003096609.1.55387 WP_003096609.1.55400 WP_003096609.1.55445 WP_003096609.1.55478 WP_003096609.1.55543 WP_003096609.1.55729 WP_003096609.1.55813 WP_003096609.1.56013 WP_003096609.1.56037 WP_003096609.1.56145 WP_003096609.1.56171 WP_003096609.1.56187 WP_003096609.1.56188 WP_003096609.1.56196 WP_003096609.1.56228 WP_003096609.1.56229 WP_003096609.1.56315 WP_003096609.1.56348 WP_003096609.1.56442 WP_003096609.1.56452 WP_003096609.1.56465 WP_003096609.1.56474 WP_003096609.1.56475 WP_003096609.1.56623 WP_003096609.1.56626 WP_003096609.1.56632 WP_003096609.1.56745 WP_003096609.1.56768 WP_003096609.1.56797 WP_003096609.1.56808 WP_003096609.1.56819 WP_003096609.1.56837 WP_003096609.1.56864 WP_003096609.1.56973 WP_003096609.1.57005 WP_003096609.1.57020 WP_003096609.1.57065 WP_003096609.1.57113 WP_003096609.1.57131 WP_003096609.1.57140 WP_003096609.1.57276 WP_003096609.1.5731 WP_003096609.1.57339 WP_003096609.1.57369 WP_003096609.1.57417 WP_003096609.1.57460 WP_003096609.1.57480 WP_003096609.1.57532 WP_003096609.1.57548 WP_003096609.1.57566 WP_003096609.1.57728 WP_003096609.1.57792 WP_003096609.1.57839 WP_003096609.1.57841 WP_003096609.1.57853 WP_003096609.1.57921 WP_003096609.1.57966 WP_003096609.1.58019 WP_003096609.1.58056 WP_003096609.1.58155 WP_003096609.1.58162 WP_003096609.1.58183 WP_003096609.1.58193 WP_003096609.1.58200 WP_003096609.1.58228 WP_003096609.1.58294 WP_003096609.1.58360 WP_003096609.1.58417 WP_003096609.1.58436 WP_003096609.1.58482 WP_003096609.1.5850 WP_003096609.1.58510 WP_003096609.1.58527 WP_003096609.1.5856 WP_003096609.1.58581 WP_003096609.1.58689 WP_003096609.1.5869 WP_003096609.1.58785 WP_003096609.1.58800 WP_003096609.1.58838 WP_003096609.1.58845 WP_003096609.1.5889 WP_003096609.1.58944 WP_003096609.1.58952 WP_003096609.1.5897 WP_003096609.1.59013 WP_003096609.1.59076 WP_003096609.1.59099 WP_003096609.1.59123 WP_003096609.1.59156 WP_003096609.1.59158 WP_003096609.1.59176 WP_003096609.1.59212 WP_003096609.1.59246 WP_003096609.1.59249 WP_003096609.1.59250 WP_003096609.1.59288 WP_003096609.1.59339 WP_003096609.1.5937 WP_003096609.1.59376 WP_003096609.1.59385 WP_003096609.1.594 WP_003096609.1.59469 WP_003096609.1.59563 WP_003096609.1.59688 WP_003096609.1.59724 WP_003096609.1.59759 WP_003096609.1.59797 WP_003096609.1.59831 WP_003096609.1.59870 WP_003096609.1.59943 WP_003096609.1.60051 WP_003096609.1.60062 WP_003096609.1.60079 WP_003096609.1.60082 WP_003096609.1.60084 WP_003096609.1.60085 WP_003096609.1.60206 WP_003096609.1.60261 WP_003096609.1.60347 WP_003096609.1.60364 WP_003096609.1.60396 WP_003096609.1.60415 WP_003096609.1.60467 WP_003096609.1.60472 WP_003096609.1.60509 WP_003096609.1.60600 WP_003096609.1.60602 WP_003096609.1.60603 WP_003096609.1.60639 WP_003096609.1.60679 WP_003096609.1.60686 WP_003096609.1.607 WP_003096609.1.60850 WP_003096609.1.60910 WP_003096609.1.60916 WP_003096609.1.60970 WP_003096609.1.60979 WP_003096609.1.61122 WP_003096609.1.61130 WP_003096609.1.61191 WP_003096609.1.61209 WP_003096609.1.61222 WP_003096609.1.61269 WP_003096609.1.61288 WP_003096609.1.61294 WP_003096609.1.61299 WP_003096609.1.6130 WP_003096609.1.61366 WP_003096609.1.61431 WP_003096609.1.61493 WP_003096609.1.61549 WP_003096609.1.61589 WP_003096609.1.61598 WP_003096609.1.616 WP_003096609.1.61696 WP_003096609.1.6173 WP_003096609.1.61943 WP_003096609.1.62010 WP_003096609.1.62035 WP_003096609.1.62180 WP_003096609.1.62186 WP_003096609.1.62211 WP_003096609.1.62263 WP_003096609.1.62357 WP_003096609.1.62396 WP_003096609.1.62410 WP_003096609.1.6242 WP_003096609.1.62483 WP_003096609.1.62516 WP_003096609.1.62534 WP_003096609.1.626 WP_003096609.1.62604 WP_003096609.1.62635 WP_003096609.1.62688 WP_003096609.1.62701 WP_003096609.1.62703 WP_003096609.1.62704 WP_003096609.1.62708 WP_003096609.1.62716 WP_003096609.1.62768 WP_003096609.1.62772 WP_003096609.1.6280 WP_003096609.1.6283 WP_003096609.1.62834 WP_003096609.1.62838 WP_003096609.1.62873 WP_003096609.1.62917 WP_003096609.1.62961 WP_003096609.1.62977 WP_003096609.1.63038 WP_003096609.1.63041 WP_003096609.1.63057 WP_003096609.1.63124 WP_003096609.1.63193 WP_003096609.1.63196 WP_003096609.1.63338 WP_003096609.1.63369 WP_003096609.1.63401 WP_003096609.1.63591 WP_003096609.1.63597 WP_003096609.1.63634 WP_003096609.1.63659 WP_003096609.1.63739 WP_003096609.1.63784 WP_003096609.1.63929 WP_003096609.1.63941 WP_003096609.1.63989 WP_003096609.1.63995 WP_003096609.1.64139 WP_003096609.1.64155 WP_003096609.1.64198 WP_003096609.1.64212 WP_003096609.1.64309 WP_003096609.1.64329 WP_003096609.1.64340 WP_003096609.1.64433 WP_003096609.1.6450 WP_003096609.1.64544 WP_003096609.1.64591 WP_003096609.1.64603 WP_003096609.1.64605 WP_003096609.1.6461 WP_003096609.1.64611 WP_003096609.1.64726 WP_003096609.1.64748 WP_003096609.1.64799 WP_003096609.1.64807 WP_003096609.1.64854 WP_003096609.1.64862 WP_003096609.1.64880 WP_003096609.1.64885 WP_003096609.1.64886 WP_003096609.1.64983 WP_003096609.1.64984 WP_003096609.1.65009 WP_003096609.1.65066 WP_003096609.1.65092 WP_003096609.1.65095 WP_003096609.1.65099 WP_003096609.1.65145 WP_003096609.1.65196 WP_003096609.1.65197 WP_003096609.1.65227 WP_003096609.1.65237 WP_003096609.1.65247 WP_003096609.1.65285 WP_003096609.1.65304 WP_003096609.1.65312 WP_003096609.1.65316 WP_003096609.1.65334 WP_003096609.1.65335 WP_003096609.1.65337 WP_003096609.1.65457 WP_003096609.1.65478 WP_003096609.1.65549 WP_003096609.1.65588 WP_003096609.1.65632 WP_003096609.1.65642 WP_003096609.1.65679 WP_003096609.1.65740 WP_003096609.1.65779 WP_003096609.1.65819 WP_003096609.1.65867 WP_003096609.1.6589 WP_003096609.1.65926 WP_003096609.1.66062 WP_003096609.1.66088 WP_003096609.1.66155 WP_003096609.1.66165 WP_003096609.1.6627 WP_003096609.1.66277 WP_003096609.1.6629 WP_003096609.1.66345 WP_003096609.1.66348 WP_003096609.1.66364 WP_003096609.1.66371 WP_003096609.1.66410 WP_003096609.1.66526 WP_003096609.1.66563 WP_003096609.1.66634 WP_003096609.1.66693 WP_003096609.1.66721 WP_003096609.1.66892 WP_003096609.1.66929 WP_003096609.1.66931 WP_003096609.1.66945 WP_003096609.1.66950 WP_003096609.1.66982 WP_003096609.1.67010 WP_003096609.1.67124 WP_003096609.1.67188 WP_003096609.1.67192 WP_003096609.1.67205 WP_003096609.1.67261 WP_003096609.1.67269 WP_003096609.1.6734 WP_003096609.1.67370 WP_003096609.1.67388 WP_003096609.1.67472 WP_003096609.1.67489 WP_003096609.1.67506 WP_003096609.1.67526 WP_003096609.1.67531 WP_003096609.1.67545 WP_003096609.1.6768 WP_003096609.1.67686 WP_003096609.1.67755 WP_003096609.1.67830 WP_003096609.1.67874 WP_003096609.1.67875 WP_003096609.1.67899 WP_003096609.1.67903 WP_003096609.1.67937 WP_003096609.1.6796 WP_003096609.1.68000 WP_003096609.1.6808 WP_003096609.1.68158 WP_003096609.1.68162 WP_003096609.1.68172 WP_003096609.1.68183 WP_003096609.1.68194 WP_003096609.1.68252 WP_003096609.1.68317 WP_003096609.1.68446 WP_003096609.1.68448 WP_003096609.1.68472 WP_003096609.1.68499 WP_003096609.1.6850 WP_003096609.1.68541 WP_003096609.1.68561 WP_003096609.1.68568 WP_003096609.1.68638 WP_003096609.1.6866 WP_003096609.1.68756 WP_003096609.1.68781 WP_003096609.1.68790 WP_003096609.1.68800 WP_003096609.1.68802 WP_003096609.1.68850 WP_003096609.1.68857 WP_003096609.1.68862 WP_003096609.1.68881 WP_003096609.1.68910 WP_003096609.1.68938 WP_003096609.1.68979 WP_003096609.1.69088 WP_003096609.1.6911 WP_003096609.1.69159 WP_003096609.1.69209 WP_003096609.1.69260 WP_003096609.1.6928 WP_003096609.1.6931 WP_003096609.1.69330 WP_003096609.1.6937 WP_003096609.1.69411 WP_003096609.1.69534 WP_003096609.1.69556 WP_003096609.1.69599 WP_003096609.1.69702 WP_003096609.1.69788 WP_003096609.1.69791 WP_003096609.1.69819 WP_003096609.1.69834 WP_003096609.1.69907 WP_003096609.1.69993 WP_003096609.1.70092 WP_003096609.1.70098 WP_003096609.1.70138 WP_003096609.1.70168 WP_003096609.1.70194 WP_003096609.1.70216 WP_003096609.1.70229 WP_003096609.1.70460 WP_003096609.1.70470 WP_003096609.1.70537 WP_003096609.1.70561 WP_003096609.1.70583 WP_003096609.1.70648 WP_003096609.1.70650 WP_003096609.1.70670 WP_003096609.1.70693 WP_003096609.1.7077 WP_003096609.1.70778 WP_003096609.1.70831 WP_003096609.1.70991 WP_003096609.1.71038 WP_003096609.1.71141 WP_003096609.1.71203 WP_003096609.1.71234 WP_003096609.1.71249 WP_003096609.1.71254 WP_003096609.1.7128 WP_003096609.1.71290 WP_003096609.1.71346 WP_003096609.1.71385 WP_003096609.1.71412 WP_003096609.1.71570 WP_003096609.1.71610 WP_003096609.1.7163 WP_003096609.1.71642 WP_003096609.1.71666 WP_003096609.1.71738 WP_003096609.1.71799 WP_003096609.1.71806 WP_003096609.1.71822 WP_003096609.1.71862 WP_003096609.1.71866 WP_003096609.1.71891 WP_003096609.1.71927 WP_003096609.1.71934 WP_003096609.1.72149 WP_003096609.1.72167 WP_003096609.1.72181 WP_003096609.1.72183 WP_003096609.1.7219 WP_003096609.1.72287 WP_003096609.1.72323 WP_003096609.1.72331 WP_003096609.1.72346 WP_003096609.1.72378 WP_003096609.1.72447 WP_003096609.1.72458 WP_003096609.1.72477 WP_003096609.1.72541 WP_003096609.1.72562 WP_003096609.1.72570 WP_003096609.1.72662 WP_003096609.1.72669 WP_003096609.1.72727 WP_003096609.1.7276 WP_003096609.1.72768 WP_003096609.1.72772 WP_003096609.1.72782 WP_003096609.1.72845 WP_003096609.1.72920 WP_003096609.1.73035 WP_003096609.1.73048 WP_003096609.1.7308 WP_003096609.1.73135 WP_003096609.1.73149 WP_003096609.1.73172 WP_003096609.1.73192 WP_003096609.1.7327 WP_003096609.1.7329 WP_003096609.1.733 WP_003096609.1.73455 WP_003096609.1.73490 WP_003096609.1.73523 WP_003096609.1.73541 WP_003096609.1.73601 WP_003096609.1.73651 WP_003096609.1.73719 WP_003096609.1.73728 WP_003096609.1.7377 WP_003096609.1.73791 WP_003096609.1.7382 WP_003096609.1.73860 WP_003096609.1.73889 WP_003096609.1.73911 WP_003096609.1.73941 WP_003096609.1.74 WP_003096609.1.74000 WP_003096609.1.74072 WP_003096609.1.74074 WP_003096609.1.7408 WP_003096609.1.74106 WP_003096609.1.74167 WP_003096609.1.74175 WP_003096609.1.74180 WP_003096609.1.74182 WP_003096609.1.74219 WP_003096609.1.74264 WP_003096609.1.74268 WP_003096609.1.74281 WP_003096609.1.74287 WP_003096609.1.74326 WP_003096609.1.7445 WP_003096609.1.74458 WP_003096609.1.74473 WP_003096609.1.74475 WP_003096609.1.7448 WP_003096609.1.74518 WP_003096609.1.7456 WP_003096609.1.74568 WP_003096609.1.74604 WP_003096609.1.74629 WP_003096609.1.74637 WP_003096609.1.74685 WP_003096609.1.74772 WP_003096609.1.74776 WP_003096609.1.748 WP_003096609.1.74878 WP_003096609.1.74941 WP_003096609.1.74948 WP_003096609.1.74958 WP_003096609.1.7501 WP_003096609.1.75041 WP_003096609.1.75119 WP_003096609.1.75204 WP_003096609.1.75277 WP_003096609.1.75303 WP_003096609.1.75389 WP_003096609.1.75431 WP_003096609.1.7547 WP_003096609.1.75549 WP_003096609.1.75573 WP_003096609.1.75580 WP_003096609.1.75599 WP_003096609.1.75603 WP_003096609.1.75631 WP_003096609.1.7568 WP_003096609.1.75756 WP_003096609.1.75771 WP_003096609.1.75792 WP_003096609.1.75825 WP_003096609.1.75826 WP_003096609.1.75860 WP_003096609.1.75935 WP_003096609.1.75938 WP_003096609.1.75947 WP_003096609.1.7595 WP_003096609.1.76077 WP_003096609.1.76092 WP_003096609.1.76141 WP_003096609.1.76145 WP_003096609.1.76192 WP_003096609.1.76322 WP_003096609.1.76383 WP_003096609.1.76399 WP_003096609.1.76441 WP_003096609.1.76467 WP_003096609.1.76484 WP_003096609.1.76543 WP_003096609.1.76600 WP_003096609.1.76633 WP_003096609.1.7666 WP_003096609.1.76716 WP_003096609.1.76775 WP_003096609.1.76791 WP_003096609.1.76861 WP_003096609.1.76922 WP_003096609.1.76985 WP_003096609.1.77235 WP_003096609.1.77238 WP_003096609.1.77286 WP_003096609.1.77317 WP_003096609.1.77442 WP_003096609.1.77476 WP_003096609.1.77490 WP_003096609.1.77566 WP_003096609.1.77574 WP_003096609.1.77587 WP_003096609.1.77686 WP_003096609.1.77750 WP_003096609.1.77769 WP_003096609.1.7779 WP_003096609.1.77819 WP_003096609.1.77834 WP_003096609.1.77913 WP_003096609.1.78104 WP_003096609.1.78112 WP_003096609.1.78118 WP_003096609.1.78134 WP_003096609.1.78148 WP_003096609.1.78158 WP_003096609.1.78288 WP_003096609.1.78380 WP_003096609.1.7840 WP_003096609.1.78409 WP_003096609.1.78425 WP_003096609.1.78430 WP_003096609.1.78437 WP_003096609.1.78570 WP_003096609.1.78599 WP_003096609.1.78623 WP_003096609.1.78669 WP_003096609.1.78693 WP_003096609.1.78795 WP_003096609.1.788 WP_003096609.1.78926 WP_003096609.1.78947 WP_003096609.1.78954 WP_003096609.1.78986 WP_003096609.1.7899 WP_003096609.1.79003 WP_003096609.1.79007 WP_003096609.1.79053 WP_003096609.1.79060 WP_003096609.1.79177 WP_003096609.1.79193 WP_003096609.1.79256 WP_003096609.1.79279 WP_003096609.1.79286 WP_003096609.1.79311 WP_003096609.1.79357 WP_003096609.1.79364 WP_003096609.1.79421 WP_003096609.1.79429 WP_003096609.1.79431 WP_003096609.1.7945 WP_003096609.1.79463 WP_003096609.1.79507 WP_003096609.1.7953 WP_003096609.1.79544 WP_003096609.1.79569 WP_003096609.1.79601 WP_003096609.1.79631 WP_003096609.1.79699 WP_003096609.1.79754 WP_003096609.1.79788 WP_003096609.1.79862 WP_003096609.1.79883 WP_003096609.1.799 WP_003096609.1.79902 WP_003096609.1.79908 WP_003096609.1.79986 WP_003096609.1.8 WP_003096609.1.80033 WP_003096609.1.80068 WP_003096609.1.80087 WP_003096609.1.80102 WP_003096609.1.8013 WP_003096609.1.80174 WP_003096609.1.80258 WP_003096609.1.8028 WP_003096609.1.80306 WP_003096609.1.8038 WP_003096609.1.80410 WP_003096609.1.80411 WP_003096609.1.80454 WP_003096609.1.80481 WP_003096609.1.8051 WP_003096609.1.80535 WP_003096609.1.80572 WP_003096609.1.80627 WP_003096609.1.80632 WP_003096609.1.8064 WP_003096609.1.80644 WP_003096609.1.80645 WP_003096609.1.80683 WP_003096609.1.80715 WP_003096609.1.80720 WP_003096609.1.80785 WP_003096609.1.80846 WP_003096609.1.80880 WP_003096609.1.80892 WP_003096609.1.80910 WP_003096609.1.80926 WP_003096609.1.80929 WP_003096609.1.80931 WP_003096609.1.80938 WP_003096609.1.80969 WP_003096609.1.81081 WP_003096609.1.81082 WP_003096609.1.8110 WP_003096609.1.81206 WP_003096609.1.81237 WP_003096609.1.81331 WP_003096609.1.81338 WP_003096609.1.81349 WP_003096609.1.81368 WP_003096609.1.81380 WP_003096609.1.8141 WP_003096609.1.81426 WP_003096609.1.81470 WP_003096609.1.81482 WP_003096609.1.81487 WP_003096609.1.81581 WP_003096609.1.81591 WP_003096609.1.81622 WP_003096609.1.81643 WP_003096609.1.81708 WP_003096609.1.81728 WP_003096609.1.81742 WP_003096609.1.81748 WP_003096609.1.81771 WP_003096609.1.81784 WP_003096609.1.81802 WP_003096609.1.81816 WP_003096609.1.81834 WP_003096609.1.81844 WP_003096609.1.81856 WP_003096609.1.81874 WP_003096609.1.81927 WP_003096609.1.81950 WP_003096609.1.81957 WP_003096609.1.81960 WP_003096609.1.81986 WP_003096609.1.82117 WP_003096609.1.82127 WP_003096609.1.82178 WP_003096609.1.82260 WP_003096609.1.8227 WP_003096609.1.82310 WP_003096609.1.82312 WP_003096609.1.82328 WP_003096609.1.82334 WP_003096609.1.8238 WP_003096609.1.82442 WP_003096609.1.82487 WP_003096609.1.82580 WP_003096609.1.82604 WP_003096609.1.82606 WP_003096609.1.82620 WP_003096609.1.82643 WP_003096609.1.82686 WP_003096609.1.82710 WP_003096609.1.82798 WP_003096609.1.82810 WP_003096609.1.8284 WP_003096609.1.82864 WP_003096609.1.82882 WP_003096609.1.82887 WP_003096609.1.82936 WP_003096609.1.83025 WP_003096609.1.83131 WP_003096609.1.83184 WP_003096609.1.83213 WP_003096609.1.83251 WP_003096609.1.83267 WP_003096609.1.83296 WP_003096609.1.83317 WP_003096609.1.83374 WP_003096609.1.83394 WP_003096609.1.83440 WP_003096609.1.83460 WP_003096609.1.83463 WP_003096609.1.835 WP_003096609.1.83503 WP_003096609.1.8351 WP_003096609.1.8353 WP_003096609.1.83534 WP_003096609.1.83540 WP_003096609.1.8357 WP_003096609.1.83637 WP_003096609.1.83673 WP_003096609.1.83698 WP_003096609.1.83715 WP_003096609.1.83871 WP_003096609.1.83937 WP_003096609.1.83946 WP_003096609.1.84003 WP_003096609.1.84008 WP_003096609.1.84138 WP_003096609.1.84162 WP_003096609.1.84174 WP_003096609.1.84177 WP_003096609.1.84178 WP_003096609.1.84190 WP_003096609.1.84203 WP_003096609.1.84271 WP_003096609.1.84297 WP_003096609.1.8437 WP_003096609.1.84374 WP_003096609.1.84398 WP_003096609.1.84404 WP_003096609.1.84439 WP_003096609.1.84471 WP_003096609.1.84487 WP_003096609.1.84526 WP_003096609.1.8453 WP_003096609.1.84538 WP_003096609.1.84558 WP_003096609.1.84589 WP_003096609.1.84674 WP_003096609.1.84684 WP_003096609.1.84702 WP_003096609.1.84715 WP_003096609.1.84754 WP_003096609.1.84792 WP_003096609.1.84825 WP_003096609.1.8484 WP_003096609.1.84865 WP_003096609.1.84937 WP_003096609.1.84946 WP_003096609.1.8498 WP_003096609.1.85018 WP_003096609.1.85028 WP_003096609.1.85059 WP_003096609.1.85150 WP_003096609.1.85220 WP_003096609.1.85290 WP_003096609.1.85298 WP_003096609.1.85303 WP_003096609.1.85311 WP_003096609.1.85318 WP_003096609.1.85357 WP_003096609.1.85446 WP_003096609.1.85453 WP_003096609.1.85574 WP_003096609.1.85633 WP_003096609.1.85638 WP_003096609.1.85788 WP_003096609.1.85897 WP_003096609.1.85910 WP_003096609.1.85920 WP_003096609.1.85978 WP_003096609.1.86002 WP_003096609.1.86047 WP_003096609.1.86055 WP_003096609.1.86058 WP_003096609.1.861 WP_003096609.1.86125 WP_003096609.1.86182 WP_003096609.1.86243 WP_003096609.1.86278 WP_003096609.1.86287 WP_003096609.1.86293 WP_003096609.1.86386 WP_003096609.1.86432 WP_003096609.1.8645 WP_003096609.1.865 WP_003096609.1.86506 WP_003096609.1.86545 WP_003096609.1.86552 WP_003096609.1.86554 WP_003096609.1.86595 WP_003096609.1.86652 WP_003096609.1.86665 WP_003096609.1.867 WP_003096609.1.86708 WP_003096609.1.86733 WP_003096609.1.86774 WP_003096609.1.86780 WP_003096609.1.86785 WP_003096609.1.86796 WP_003096609.1.86813 WP_003096609.1.86822 WP_003096609.1.8693 WP_003096609.1.86947 WP_003096609.1.86970 WP_003096609.1.86985 WP_003096609.1.87104 WP_003096609.1.87163 WP_003096609.1.8718 WP_003096609.1.87182 WP_003096609.1.87183 WP_003096609.1.8727 WP_003096609.1.87316 WP_003096609.1.87390 WP_003096609.1.87435 WP_003096609.1.87463 WP_003096609.1.8749 WP_003096609.1.87530 WP_003096609.1.87547 WP_003096609.1.87648 WP_003096609.1.87763 WP_003096609.1.8777 WP_003096609.1.8785 WP_003096609.1.87877 WP_003096609.1.87888 WP_003096609.1.87970 WP_003096609.1.87975 WP_003096609.1.87981 WP_003096609.1.87987 WP_003096609.1.88004 WP_003096609.1.88152 WP_003096609.1.88330 WP_003096609.1.88360 WP_003096609.1.88388 WP_003096609.1.88415 WP_003096609.1.88517 WP_003096609.1.8852 WP_003096609.1.88540 WP_003096609.1.88550 WP_003096609.1.88578 WP_003096609.1.88605 WP_003096609.1.88659 WP_003096609.1.88679 WP_003096609.1.88680 WP_003096609.1.88714 WP_003096609.1.88750 WP_003096609.1.88796 WP_003096609.1.889 WP_003096609.1.88900 WP_003096609.1.88949 WP_003096609.1.88969 WP_003096609.1.89083 WP_003096609.1.89098 WP_003096609.1.8911 WP_003096609.1.89234 WP_003096609.1.89245 WP_003096609.1.89276 WP_003096609.1.89330 WP_003096609.1.89409 WP_003096609.1.89434 WP_003096609.1.89440 WP_003096609.1.89480 WP_003096609.1.8949 WP_003096609.1.89491 WP_003096609.1.89523 WP_003096609.1.89577 WP_003096609.1.89610 WP_003096609.1.89638 WP_003096609.1.89662 WP_003096609.1.89669 WP_003096609.1.89736 WP_003096609.1.8976 WP_003096609.1.89776 WP_003096609.1.89805 WP_003096609.1.89866 WP_003096609.1.89867 WP_003096609.1.89868 WP_003096609.1.89871 WP_003096609.1.89886 WP_003096609.1.89992 WP_003096609.1.90024 WP_003096609.1.90032 WP_003096609.1.90056 WP_003096609.1.90110 WP_003096609.1.90141 WP_003096609.1.90150 WP_003096609.1.90189 WP_003096609.1.90224 WP_003096609.1.90225 WP_003096609.1.90242 WP_003096609.1.90268 WP_003096609.1.90272 WP_003096609.1.90306 WP_003096609.1.90412 WP_003096609.1.9056 WP_003096609.1.90569 WP_003096609.1.90655 WP_003096609.1.90770 WP_003096609.1.90940 WP_003096609.1.90999 WP_003096609.1.91012 WP_003096609.1.91093 WP_003096609.1.91161 WP_003096609.1.9120 WP_003096609.1.91204 WP_003096609.1.91236 WP_003096609.1.91281 WP_003096609.1.91336 WP_003096609.1.91360 WP_003096609.1.91392 WP_003096609.1.91416 WP_003096609.1.9143 WP_003096609.1.91431 WP_003096609.1.91438 WP_003096609.1.91467 WP_003096609.1.91527 WP_003096609.1.91563 WP_003096609.1.91585 WP_003096609.1.91796 WP_003096609.1.91803 WP_003096609.1.9182 WP_003096609.1.91838 WP_003096609.1.91846 WP_003096609.1.91860 WP_003096609.1.91862 WP_003096609.1.91882 WP_003096609.1.9191 WP_003096609.1.91938 WP_003096609.1.91943 WP_003096609.1.91996 WP_003096609.1.92175 WP_003096609.1.9219 WP_003096609.1.92314 WP_003096609.1.92321 WP_003096609.1.92357 WP_003096609.1.92454 WP_003096609.1.92573 WP_003096609.1.92585 WP_003096609.1.92587 WP_003096609.1.92589 WP_003096609.1.92594 WP_003096609.1.92624 WP_003096609.1.92630 WP_003096609.1.92642 WP_003096609.1.9272 WP_003096609.1.92759 WP_003096609.1.92769 WP_003096609.1.92839 WP_003096609.1.92847 WP_003096609.1.92894 WP_003096609.1.92924 WP_003096609.1.92930 WP_003096609.1.93001 WP_003096609.1.93090 WP_003096609.1.93122 WP_003096609.1.93130 WP_003096609.1.93144 WP_003096609.1.93148 WP_003096609.1.93196 WP_003096609.1.93250 WP_003096609.1.93264 WP_003096609.1.9328 WP_003096609.1.93446 WP_003096609.1.9349 WP_003096609.1.93493 WP_003096609.1.93498 WP_003096609.1.93520 WP_003096609.1.93547 WP_003096609.1.93562 WP_003096609.1.93568 WP_003096609.1.93797 WP_003096609.1.93848 WP_003096609.1.93889 WP_003096609.1.93897 WP_003096609.1.94004 WP_003096609.1.94031 WP_003096609.1.94065 WP_003096609.1.94078 WP_003096609.1.94136 WP_003096609.1.94174 WP_003096609.1.94211 WP_003096609.1.94218 WP_003096609.1.94221 WP_003096609.1.94230 WP_003096609.1.94243 WP_003096609.1.94285 WP_003096609.1.94288 WP_003096609.1.94333 WP_003096609.1.94349 WP_003096609.1.94385 WP_003096609.1.94422 WP_003096609.1.94434 WP_003096609.1.9444 WP_003096609.1.94450 WP_003096609.1.94682 WP_003096609.1.94732 WP_003096609.1.94742 WP_003096609.1.94814 WP_003096609.1.94818 WP_003096609.1.94856 WP_003096609.1.94874 WP_003096609.1.94881 WP_003096609.1.94896 WP_003096609.1.94897 WP_003096609.1.94943 WP_003096609.1.95018 WP_003096609.1.95025 WP_003096609.1.95027 WP_003096609.1.95056 WP_003096609.1.95117 WP_003096609.1.95132 WP_003096609.1.95187 WP_003096609.1.95207 WP_003096609.1.95217 WP_003096609.1.95305 WP_003096609.1.95324 WP_003096609.1.95354 WP_003096609.1.95359 WP_003096609.1.95460 WP_003096609.1.95488 WP_003096609.1.95525 WP_003096609.1.95536 WP_003096609.1.95638 WP_003096609.1.95668 WP_003096609.1.95745 WP_003096609.1.95751 WP_003096609.1.95774 WP_003096609.1.95782 WP_003096609.1.95787 WP_003096609.1.95802 WP_003096609.1.95820 WP_003096609.1.95825 WP_003096609.1.95959 WP_003096609.1.9599 WP_003096609.1.95994 WP_003096609.1.95999 WP_003096609.1.96008 WP_003096609.1.9604 WP_003096609.1.96041 WP_003096609.1.96058 WP_003096609.1.961 WP_003096609.1.96134 WP_003096609.1.96193 WP_003096609.1.96243 WP_003096609.1.96267 WP_003096609.1.96357 WP_003096609.1.96384 WP_003096609.1.96434 WP_003096609.1.96452 WP_003096609.1.96506 WP_003096609.1.96667 WP_003096609.1.96702 WP_003096609.1.96714 WP_003096609.1.96863 WP_003096609.1.96880 WP_003096609.1.96967 WP_003096609.1.9706 WP_003096609.1.97118 WP_003096609.1.97126 WP_003096609.1.97204 WP_003096609.1.97213 WP_003096609.1.9722 WP_003096609.1.97271 WP_003096609.1.97272 WP_003096609.1.97377 WP_003096609.1.97461 WP_003096609.1.97474 WP_003096609.1.97488 WP_003096609.1.97499 WP_003096609.1.97503 WP_003096609.1.97521 WP_003096609.1.97583 WP_003096609.1.97614 WP_003096609.1.977 WP_003096609.1.97784 WP_003096609.1.97826 WP_003096609.1.97877 WP_003096609.1.97968 WP_003096609.1.98111 WP_003096609.1.98260 WP_003096609.1.98276 WP_003096609.1.98308 WP_003096609.1.98410 WP_003096609.1.98414 WP_003096609.1.98433 WP_003096609.1.9845 WP_003096609.1.985 WP_003096609.1.98515 WP_003096609.1.98522 WP_003096609.1.98573 WP_003096609.1.98600 WP_003096609.1.98610 WP_003096609.1.98672 WP_003096609.1.98678 WP_003096609.1.98693 WP_003096609.1.98788 WP_003096609.1.98814 WP_003096609.1.9885 WP_003096609.1.98873 WP_003096609.1.98907 WP_003096609.1.98926 WP_003096609.1.98958 WP_003096609.1.98960 WP_003096609.1.98963 WP_003096609.1.99065 WP_003096609.1.99068 WP_003096609.1.99103 WP_003096609.1.99214 WP_003096609.1.99293 WP_003096609.1.99378 WP_003096609.1.99386 WP_003096609.1.99389 WP_003096609.1.99443 WP_003096609.1.99461 WP_003096609.1.9951 WP_003096609.1.99516 WP_003096609.1.99647 WP_003096609.1.99654 WP_003096609.1.99662 WP_003096609.1.99746 WP_003096609.1.99757 WP_003096609.1.99772 WP_003096609.1.99795 WP_003096609.1.99835 WP_003096609.1.9989 WP_003096609.1.99930 gi|478481798|ref|YP_007712449.1| gi|392987062|ref|YP_006485649.1| gi|386068995|ref|YP_005984299.1| gi|514412444|ref|YP_008135998.1| 208963.PA14_70480 208964.PA5339 557722.PLES_57341 gi|564955732|ref|YP_008888302.1| gi|558669179|ref|YP_008805889.1| gi|15600532|ref|NP_254026.1| gi|558675530|ref|YP_008812238.1| gi|116053486|ref|YP_793813.1| gi|218894442|ref|YP_002443312.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]