SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|568156922|ref|YP_008945915.1| from Pseudomonas aeruginosa LES431

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|568156922|ref|YP_008945915.1|
Domain Number 1 Region: 24-137
Classification Level Classification E-value
Superfamily YjgF-like 2.83e-32
Family YjgF/L-PSP 0.0009
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|568156922|ref|YP_008945915.1|
Sequence length 140
Comment endoribonuclease [Pseudomonas aeruginosa LES431]
Sequence
MPTHTRIRMFNTKDTYPNQSLDNDLCQAVRAGNTVYVRGQVGTDFDGNLVGLGDPRAQAE
QAMKNVKQLLEEAGSDLSHIVKTTTYLIDPRYREPVYREVGKWLKGVFPISTGLVVSALG
QPQWLMEIDVIAVIPDDWQQ
Download sequence
Identical sequences A0A069Q5I1 A0A0E1B2A7 A0A0H2ZJJ9 A0A0H3QRL0 A0A157WGM7 A0A1C7BCF4 A0A1E9BZB1 A0A1F0IFH5 A0A1G5LPG7 A0A1S1BVB8 A6VEK4 Q9HTH2 V6APC5 W1MWN6
gi|152987649|ref|YP_001351489.1| gi|558675580|ref|YP_008812288.1| NP_254079.1.87394 WP_003096732.1.100071 WP_003096732.1.100100 WP_003096732.1.100179 WP_003096732.1.100276 WP_003096732.1.100278 WP_003096732.1.100319 WP_003096732.1.100394 WP_003096732.1.100420 WP_003096732.1.100456 WP_003096732.1.100469 WP_003096732.1.100473 WP_003096732.1.100476 WP_003096732.1.100523 WP_003096732.1.100654 WP_003096732.1.100723 WP_003096732.1.100742 WP_003096732.1.100777 WP_003096732.1.100786 WP_003096732.1.100808 WP_003096732.1.100809 WP_003096732.1.100810 WP_003096732.1.100872 WP_003096732.1.100983 WP_003096732.1.100995 WP_003096732.1.101021 WP_003096732.1.101047 WP_003096732.1.101090 WP_003096732.1.101269 WP_003096732.1.101310 WP_003096732.1.101340 WP_003096732.1.101506 WP_003096732.1.101572 WP_003096732.1.101590 WP_003096732.1.101642 WP_003096732.1.101712 WP_003096732.1.101739 WP_003096732.1.10174 WP_003096732.1.101781 WP_003096732.1.10179 WP_003096732.1.101809 WP_003096732.1.101819 WP_003096732.1.10185 WP_003096732.1.101863 WP_003096732.1.101871 WP_003096732.1.10201 WP_003096732.1.10202 WP_003096732.1.10204 WP_003096732.1.102045 WP_003096732.1.10228 WP_003096732.1.10248 WP_003096732.1.10257 WP_003096732.1.10271 WP_003096732.1.1037 WP_003096732.1.10407 WP_003096732.1.10419 WP_003096732.1.10435 WP_003096732.1.10468 WP_003096732.1.10477 WP_003096732.1.10482 WP_003096732.1.10513 WP_003096732.1.10529 WP_003096732.1.10548 WP_003096732.1.10572 WP_003096732.1.10575 WP_003096732.1.10636 WP_003096732.1.10641 WP_003096732.1.10684 WP_003096732.1.10764 WP_003096732.1.10856 WP_003096732.1.10895 WP_003096732.1.10901 WP_003096732.1.10949 WP_003096732.1.11026 WP_003096732.1.11058 WP_003096732.1.1107 WP_003096732.1.11077 WP_003096732.1.11130 WP_003096732.1.11163 WP_003096732.1.11178 WP_003096732.1.11180 WP_003096732.1.11318 WP_003096732.1.11381 WP_003096732.1.11388 WP_003096732.1.11417 WP_003096732.1.11454 WP_003096732.1.11568 WP_003096732.1.11569 WP_003096732.1.11653 WP_003096732.1.11744 WP_003096732.1.11754 WP_003096732.1.1180 WP_003096732.1.1183 WP_003096732.1.11847 WP_003096732.1.11854 WP_003096732.1.1187 WP_003096732.1.11943 WP_003096732.1.12018 WP_003096732.1.12081 WP_003096732.1.12120 WP_003096732.1.12150 WP_003096732.1.12200 WP_003096732.1.12208 WP_003096732.1.12240 WP_003096732.1.12302 WP_003096732.1.12354 WP_003096732.1.1238 WP_003096732.1.12400 WP_003096732.1.12482 WP_003096732.1.12497 WP_003096732.1.12530 WP_003096732.1.12547 WP_003096732.1.12561 WP_003096732.1.12657 WP_003096732.1.12660 WP_003096732.1.12670 WP_003096732.1.12687 WP_003096732.1.12744 WP_003096732.1.12797 WP_003096732.1.12838 WP_003096732.1.12873 WP_003096732.1.12890 WP_003096732.1.12891 WP_003096732.1.12922 WP_003096732.1.12930 WP_003096732.1.12934 WP_003096732.1.12970 WP_003096732.1.12980 WP_003096732.1.13 WP_003096732.1.13041 WP_003096732.1.1305 WP_003096732.1.13057 WP_003096732.1.13077 WP_003096732.1.13085 WP_003096732.1.13092 WP_003096732.1.13208 WP_003096732.1.13232 WP_003096732.1.13242 WP_003096732.1.13266 WP_003096732.1.13270 WP_003096732.1.1333 WP_003096732.1.13364 WP_003096732.1.13407 WP_003096732.1.13529 WP_003096732.1.13533 WP_003096732.1.1356 WP_003096732.1.1362 WP_003096732.1.13622 WP_003096732.1.13642 WP_003096732.1.13718 WP_003096732.1.13743 WP_003096732.1.13758 WP_003096732.1.13765 WP_003096732.1.13785 WP_003096732.1.13795 WP_003096732.1.13828 WP_003096732.1.13865 WP_003096732.1.1393 WP_003096732.1.14049 WP_003096732.1.14078 WP_003096732.1.14096 WP_003096732.1.14116 WP_003096732.1.14204 WP_003096732.1.14251 WP_003096732.1.14345 WP_003096732.1.14378 WP_003096732.1.14424 WP_003096732.1.14455 WP_003096732.1.14460 WP_003096732.1.14463 WP_003096732.1.14476 WP_003096732.1.14525 WP_003096732.1.14615 WP_003096732.1.14640 WP_003096732.1.14679 WP_003096732.1.14690 WP_003096732.1.14714 WP_003096732.1.1475 WP_003096732.1.14754 WP_003096732.1.14797 WP_003096732.1.14815 WP_003096732.1.14820 WP_003096732.1.14835 WP_003096732.1.14839 WP_003096732.1.14883 WP_003096732.1.14966 WP_003096732.1.14981 WP_003096732.1.15004 WP_003096732.1.15130 WP_003096732.1.1516 WP_003096732.1.152 WP_003096732.1.15222 WP_003096732.1.15231 WP_003096732.1.15281 WP_003096732.1.15297 WP_003096732.1.15328 WP_003096732.1.15373 WP_003096732.1.15379 WP_003096732.1.15408 WP_003096732.1.15474 WP_003096732.1.15480 WP_003096732.1.15482 WP_003096732.1.15485 WP_003096732.1.15602 WP_003096732.1.15606 WP_003096732.1.15666 WP_003096732.1.15692 WP_003096732.1.15886 WP_003096732.1.15889 WP_003096732.1.15934 WP_003096732.1.16041 WP_003096732.1.16074 WP_003096732.1.16109 WP_003096732.1.16142 WP_003096732.1.16197 WP_003096732.1.162 WP_003096732.1.16239 WP_003096732.1.16242 WP_003096732.1.16267 WP_003096732.1.16279 WP_003096732.1.16419 WP_003096732.1.16660 WP_003096732.1.16694 WP_003096732.1.1670 WP_003096732.1.1671 WP_003096732.1.16751 WP_003096732.1.16782 WP_003096732.1.16788 WP_003096732.1.16801 WP_003096732.1.16811 WP_003096732.1.16895 WP_003096732.1.17022 WP_003096732.1.1704 WP_003096732.1.17108 WP_003096732.1.17155 WP_003096732.1.17162 WP_003096732.1.17177 WP_003096732.1.17189 WP_003096732.1.172 WP_003096732.1.17223 WP_003096732.1.17353 WP_003096732.1.17354 WP_003096732.1.17370 WP_003096732.1.1739 WP_003096732.1.17397 WP_003096732.1.17499 WP_003096732.1.17566 WP_003096732.1.1758 WP_003096732.1.1761 WP_003096732.1.17697 WP_003096732.1.17883 WP_003096732.1.17890 WP_003096732.1.18052 WP_003096732.1.18054 WP_003096732.1.18117 WP_003096732.1.18156 WP_003096732.1.18157 WP_003096732.1.18199 WP_003096732.1.18204 WP_003096732.1.18234 WP_003096732.1.18349 WP_003096732.1.18440 WP_003096732.1.18493 WP_003096732.1.18508 WP_003096732.1.18547 WP_003096732.1.18653 WP_003096732.1.18728 WP_003096732.1.18732 WP_003096732.1.18735 WP_003096732.1.18769 WP_003096732.1.18795 WP_003096732.1.18852 WP_003096732.1.18892 WP_003096732.1.18907 WP_003096732.1.18911 WP_003096732.1.18930 WP_003096732.1.190 WP_003096732.1.19089 WP_003096732.1.19199 WP_003096732.1.19251 WP_003096732.1.19260 WP_003096732.1.19269 WP_003096732.1.19346 WP_003096732.1.19351 WP_003096732.1.19376 WP_003096732.1.1938 WP_003096732.1.19552 WP_003096732.1.19591 WP_003096732.1.19640 WP_003096732.1.19703 WP_003096732.1.1971 WP_003096732.1.19711 WP_003096732.1.19718 WP_003096732.1.19741 WP_003096732.1.19771 WP_003096732.1.19803 WP_003096732.1.19824 WP_003096732.1.19930 WP_003096732.1.19931 WP_003096732.1.20024 WP_003096732.1.20070 WP_003096732.1.2012 WP_003096732.1.20125 WP_003096732.1.20134 WP_003096732.1.20154 WP_003096732.1.20216 WP_003096732.1.20342 WP_003096732.1.20590 WP_003096732.1.20607 WP_003096732.1.20682 WP_003096732.1.20692 WP_003096732.1.20744 WP_003096732.1.20764 WP_003096732.1.20825 WP_003096732.1.20854 WP_003096732.1.20880 WP_003096732.1.20884 WP_003096732.1.20890 WP_003096732.1.209 WP_003096732.1.20929 WP_003096732.1.20978 WP_003096732.1.21002 WP_003096732.1.21039 WP_003096732.1.21096 WP_003096732.1.21100 WP_003096732.1.21166 WP_003096732.1.21209 WP_003096732.1.21242 WP_003096732.1.21253 WP_003096732.1.21302 WP_003096732.1.21349 WP_003096732.1.21358 WP_003096732.1.2144 WP_003096732.1.21448 WP_003096732.1.21460 WP_003096732.1.21469 WP_003096732.1.21517 WP_003096732.1.21607 WP_003096732.1.21718 WP_003096732.1.2172 WP_003096732.1.21744 WP_003096732.1.21767 WP_003096732.1.21782 WP_003096732.1.21801 WP_003096732.1.21863 WP_003096732.1.21871 WP_003096732.1.21891 WP_003096732.1.21932 WP_003096732.1.22078 WP_003096732.1.221 WP_003096732.1.2228 WP_003096732.1.22316 WP_003096732.1.22324 WP_003096732.1.22365 WP_003096732.1.2237 WP_003096732.1.22389 WP_003096732.1.22390 WP_003096732.1.22394 WP_003096732.1.22442 WP_003096732.1.22477 WP_003096732.1.22491 WP_003096732.1.22573 WP_003096732.1.22671 WP_003096732.1.22704 WP_003096732.1.22729 WP_003096732.1.22863 WP_003096732.1.2289 WP_003096732.1.22891 WP_003096732.1.23013 WP_003096732.1.23166 WP_003096732.1.23191 WP_003096732.1.23195 WP_003096732.1.2323 WP_003096732.1.23264 WP_003096732.1.23331 WP_003096732.1.23394 WP_003096732.1.23418 WP_003096732.1.23421 WP_003096732.1.23512 WP_003096732.1.23518 WP_003096732.1.23523 WP_003096732.1.23525 WP_003096732.1.2355 WP_003096732.1.23559 WP_003096732.1.23581 WP_003096732.1.236 WP_003096732.1.23611 WP_003096732.1.23641 WP_003096732.1.23715 WP_003096732.1.23739 WP_003096732.1.2374 WP_003096732.1.23769 WP_003096732.1.23782 WP_003096732.1.23794 WP_003096732.1.23884 WP_003096732.1.23925 WP_003096732.1.23938 WP_003096732.1.23961 WP_003096732.1.23967 WP_003096732.1.23983 WP_003096732.1.24066 WP_003096732.1.24077 WP_003096732.1.24087 WP_003096732.1.24101 WP_003096732.1.24183 WP_003096732.1.24234 WP_003096732.1.24319 WP_003096732.1.24351 WP_003096732.1.24382 WP_003096732.1.24413 WP_003096732.1.24447 WP_003096732.1.2453 WP_003096732.1.24626 WP_003096732.1.24662 WP_003096732.1.2477 WP_003096732.1.24851 WP_003096732.1.24862 WP_003096732.1.24869 WP_003096732.1.24879 WP_003096732.1.24938 WP_003096732.1.24940 WP_003096732.1.25033 WP_003096732.1.25052 WP_003096732.1.25067 WP_003096732.1.25075 WP_003096732.1.251 WP_003096732.1.25109 WP_003096732.1.2511 WP_003096732.1.25142 WP_003096732.1.25149 WP_003096732.1.25179 WP_003096732.1.25191 WP_003096732.1.25271 WP_003096732.1.2529 WP_003096732.1.2530 WP_003096732.1.25328 WP_003096732.1.25344 WP_003096732.1.25348 WP_003096732.1.2535 WP_003096732.1.25477 WP_003096732.1.25532 WP_003096732.1.25600 WP_003096732.1.25641 WP_003096732.1.25675 WP_003096732.1.25695 WP_003096732.1.2572 WP_003096732.1.25834 WP_003096732.1.25903 WP_003096732.1.2596 WP_003096732.1.25964 WP_003096732.1.26010 WP_003096732.1.26025 WP_003096732.1.26042 WP_003096732.1.261 WP_003096732.1.26159 WP_003096732.1.26301 WP_003096732.1.26334 WP_003096732.1.26428 WP_003096732.1.26463 WP_003096732.1.26473 WP_003096732.1.26489 WP_003096732.1.2652 WP_003096732.1.26539 WP_003096732.1.26553 WP_003096732.1.26592 WP_003096732.1.26604 WP_003096732.1.26681 WP_003096732.1.26705 WP_003096732.1.26740 WP_003096732.1.26816 WP_003096732.1.26841 WP_003096732.1.26862 WP_003096732.1.26906 WP_003096732.1.26967 WP_003096732.1.2698 WP_003096732.1.27018 WP_003096732.1.27028 WP_003096732.1.27039 WP_003096732.1.27073 WP_003096732.1.27107 WP_003096732.1.27211 WP_003096732.1.27259 WP_003096732.1.27288 WP_003096732.1.27505 WP_003096732.1.27534 WP_003096732.1.27549 WP_003096732.1.27575 WP_003096732.1.27587 WP_003096732.1.27687 WP_003096732.1.27738 WP_003096732.1.27772 WP_003096732.1.27783 WP_003096732.1.27825 WP_003096732.1.27837 WP_003096732.1.27858 WP_003096732.1.27933 WP_003096732.1.27939 WP_003096732.1.27966 WP_003096732.1.28006 WP_003096732.1.28057 WP_003096732.1.28064 WP_003096732.1.28078 WP_003096732.1.28136 WP_003096732.1.28193 WP_003096732.1.28258 WP_003096732.1.283 WP_003096732.1.28316 WP_003096732.1.28329 WP_003096732.1.28372 WP_003096732.1.28382 WP_003096732.1.28383 WP_003096732.1.28404 WP_003096732.1.28468 WP_003096732.1.28505 WP_003096732.1.28528 WP_003096732.1.28560 WP_003096732.1.28602 WP_003096732.1.28623 WP_003096732.1.28699 WP_003096732.1.28713 WP_003096732.1.28757 WP_003096732.1.28800 WP_003096732.1.28823 WP_003096732.1.28838 WP_003096732.1.28849 WP_003096732.1.28878 WP_003096732.1.28920 WP_003096732.1.29003 WP_003096732.1.29008 WP_003096732.1.29070 WP_003096732.1.29096 WP_003096732.1.29127 WP_003096732.1.29137 WP_003096732.1.29158 WP_003096732.1.29208 WP_003096732.1.2927 WP_003096732.1.29401 WP_003096732.1.2941 WP_003096732.1.29438 WP_003096732.1.29440 WP_003096732.1.29472 WP_003096732.1.2948 WP_003096732.1.29481 WP_003096732.1.29577 WP_003096732.1.2961 WP_003096732.1.29633 WP_003096732.1.29650 WP_003096732.1.29668 WP_003096732.1.29753 WP_003096732.1.29767 WP_003096732.1.2980 WP_003096732.1.29848 WP_003096732.1.29920 WP_003096732.1.29958 WP_003096732.1.29973 WP_003096732.1.30000 WP_003096732.1.30020 WP_003096732.1.30081 WP_003096732.1.30120 WP_003096732.1.30254 WP_003096732.1.3030 WP_003096732.1.30365 WP_003096732.1.30474 WP_003096732.1.30475 WP_003096732.1.30563 WP_003096732.1.30567 WP_003096732.1.30614 WP_003096732.1.30615 WP_003096732.1.30625 WP_003096732.1.30693 WP_003096732.1.30707 WP_003096732.1.3072 WP_003096732.1.30740 WP_003096732.1.30797 WP_003096732.1.30810 WP_003096732.1.30815 WP_003096732.1.30842 WP_003096732.1.30886 WP_003096732.1.30943 WP_003096732.1.30973 WP_003096732.1.30994 WP_003096732.1.31045 WP_003096732.1.31076 WP_003096732.1.31087 WP_003096732.1.31103 WP_003096732.1.31105 WP_003096732.1.31138 WP_003096732.1.31147 WP_003096732.1.31279 WP_003096732.1.31361 WP_003096732.1.31457 WP_003096732.1.31501 WP_003096732.1.31563 WP_003096732.1.31565 WP_003096732.1.31587 WP_003096732.1.31633 WP_003096732.1.31655 WP_003096732.1.3172 WP_003096732.1.31732 WP_003096732.1.31741 WP_003096732.1.31751 WP_003096732.1.3179 WP_003096732.1.31848 WP_003096732.1.31852 WP_003096732.1.3189 WP_003096732.1.319 WP_003096732.1.31939 WP_003096732.1.32134 WP_003096732.1.32137 WP_003096732.1.32144 WP_003096732.1.32235 WP_003096732.1.32289 WP_003096732.1.32314 WP_003096732.1.32359 WP_003096732.1.32447 WP_003096732.1.32523 WP_003096732.1.32544 WP_003096732.1.32596 WP_003096732.1.32626 WP_003096732.1.32637 WP_003096732.1.32641 WP_003096732.1.32711 WP_003096732.1.32821 WP_003096732.1.32869 WP_003096732.1.32998 WP_003096732.1.33009 WP_003096732.1.33047 WP_003096732.1.33097 WP_003096732.1.33133 WP_003096732.1.33152 WP_003096732.1.33186 WP_003096732.1.33204 WP_003096732.1.33210 WP_003096732.1.33216 WP_003096732.1.33294 WP_003096732.1.33340 WP_003096732.1.33387 WP_003096732.1.33438 WP_003096732.1.33441 WP_003096732.1.33455 WP_003096732.1.3351 WP_003096732.1.33517 WP_003096732.1.33521 WP_003096732.1.33523 WP_003096732.1.33547 WP_003096732.1.33549 WP_003096732.1.33653 WP_003096732.1.33658 WP_003096732.1.33669 WP_003096732.1.3368 WP_003096732.1.33728 WP_003096732.1.33733 WP_003096732.1.33734 WP_003096732.1.3376 WP_003096732.1.33774 WP_003096732.1.33801 WP_003096732.1.33814 WP_003096732.1.33822 WP_003096732.1.33824 WP_003096732.1.33833 WP_003096732.1.3385 WP_003096732.1.33945 WP_003096732.1.34000 WP_003096732.1.34039 WP_003096732.1.34136 WP_003096732.1.34143 WP_003096732.1.34150 WP_003096732.1.34151 WP_003096732.1.34180 WP_003096732.1.34203 WP_003096732.1.34306 WP_003096732.1.34317 WP_003096732.1.34324 WP_003096732.1.3436 WP_003096732.1.34402 WP_003096732.1.34461 WP_003096732.1.34465 WP_003096732.1.34472 WP_003096732.1.3452 WP_003096732.1.34556 WP_003096732.1.34568 WP_003096732.1.34583 WP_003096732.1.34625 WP_003096732.1.34670 WP_003096732.1.34689 WP_003096732.1.34731 WP_003096732.1.34784 WP_003096732.1.34821 WP_003096732.1.34832 WP_003096732.1.34836 WP_003096732.1.34837 WP_003096732.1.34876 WP_003096732.1.34878 WP_003096732.1.34901 WP_003096732.1.34922 WP_003096732.1.34942 WP_003096732.1.35036 WP_003096732.1.35104 WP_003096732.1.35149 WP_003096732.1.35231 WP_003096732.1.3531 WP_003096732.1.35325 WP_003096732.1.35353 WP_003096732.1.3540 WP_003096732.1.35431 WP_003096732.1.35442 WP_003096732.1.35480 WP_003096732.1.35512 WP_003096732.1.35529 WP_003096732.1.3555 WP_003096732.1.35573 WP_003096732.1.35599 WP_003096732.1.35639 WP_003096732.1.35641 WP_003096732.1.35669 WP_003096732.1.35679 WP_003096732.1.3568 WP_003096732.1.35682 WP_003096732.1.3576 WP_003096732.1.35762 WP_003096732.1.35768 WP_003096732.1.35822 WP_003096732.1.35843 WP_003096732.1.35857 WP_003096732.1.35872 WP_003096732.1.35968 WP_003096732.1.35984 WP_003096732.1.36064 WP_003096732.1.36121 WP_003096732.1.36148 WP_003096732.1.36170 WP_003096732.1.36266 WP_003096732.1.36267 WP_003096732.1.36285 WP_003096732.1.36329 WP_003096732.1.36435 WP_003096732.1.36487 WP_003096732.1.36521 WP_003096732.1.3653 WP_003096732.1.36587 WP_003096732.1.36608 WP_003096732.1.3662 WP_003096732.1.36630 WP_003096732.1.36665 WP_003096732.1.36708 WP_003096732.1.3672 WP_003096732.1.36756 WP_003096732.1.36781 WP_003096732.1.36879 WP_003096732.1.37050 WP_003096732.1.37097 WP_003096732.1.37125 WP_003096732.1.37163 WP_003096732.1.37172 WP_003096732.1.37208 WP_003096732.1.3721 WP_003096732.1.37216 WP_003096732.1.373 WP_003096732.1.37319 WP_003096732.1.37366 WP_003096732.1.37416 WP_003096732.1.3742 WP_003096732.1.37500 WP_003096732.1.37571 WP_003096732.1.3768 WP_003096732.1.37698 WP_003096732.1.37703 WP_003096732.1.3773 WP_003096732.1.37799 WP_003096732.1.3781 WP_003096732.1.37814 WP_003096732.1.37818 WP_003096732.1.37826 WP_003096732.1.37842 WP_003096732.1.3785 WP_003096732.1.3792 WP_003096732.1.38003 WP_003096732.1.38023 WP_003096732.1.38060 WP_003096732.1.38087 WP_003096732.1.38102 WP_003096732.1.38146 WP_003096732.1.38151 WP_003096732.1.3818 WP_003096732.1.38186 WP_003096732.1.3821 WP_003096732.1.38319 WP_003096732.1.3833 WP_003096732.1.38335 WP_003096732.1.38337 WP_003096732.1.38406 WP_003096732.1.38430 WP_003096732.1.38450 WP_003096732.1.38502 WP_003096732.1.38505 WP_003096732.1.38510 WP_003096732.1.38582 WP_003096732.1.38583 WP_003096732.1.38587 WP_003096732.1.38657 WP_003096732.1.38661 WP_003096732.1.3870 WP_003096732.1.38706 WP_003096732.1.38727 WP_003096732.1.38816 WP_003096732.1.38834 WP_003096732.1.3887 WP_003096732.1.38889 WP_003096732.1.38932 WP_003096732.1.38971 WP_003096732.1.39046 WP_003096732.1.39088 WP_003096732.1.39122 WP_003096732.1.39186 WP_003096732.1.39271 WP_003096732.1.39326 WP_003096732.1.39345 WP_003096732.1.3943 WP_003096732.1.39444 WP_003096732.1.39452 WP_003096732.1.39458 WP_003096732.1.39537 WP_003096732.1.39704 WP_003096732.1.39765 WP_003096732.1.39786 WP_003096732.1.39811 WP_003096732.1.39920 WP_003096732.1.39949 WP_003096732.1.3998 WP_003096732.1.39989 WP_003096732.1.40059 WP_003096732.1.40115 WP_003096732.1.40135 WP_003096732.1.40207 WP_003096732.1.40213 WP_003096732.1.40237 WP_003096732.1.40243 WP_003096732.1.40271 WP_003096732.1.4038 WP_003096732.1.40419 WP_003096732.1.40442 WP_003096732.1.40512 WP_003096732.1.40513 WP_003096732.1.40541 WP_003096732.1.40546 WP_003096732.1.4058 WP_003096732.1.40595 WP_003096732.1.40703 WP_003096732.1.40874 WP_003096732.1.40950 WP_003096732.1.40984 WP_003096732.1.40993 WP_003096732.1.40994 WP_003096732.1.41110 WP_003096732.1.41137 WP_003096732.1.41199 WP_003096732.1.41290 WP_003096732.1.41291 WP_003096732.1.41301 WP_003096732.1.41384 WP_003096732.1.41412 WP_003096732.1.41429 WP_003096732.1.41487 WP_003096732.1.41492 WP_003096732.1.41502 WP_003096732.1.4156 WP_003096732.1.41618 WP_003096732.1.41624 WP_003096732.1.41625 WP_003096732.1.41692 WP_003096732.1.41703 WP_003096732.1.41725 WP_003096732.1.41732 WP_003096732.1.41748 WP_003096732.1.41773 WP_003096732.1.41832 WP_003096732.1.41846 WP_003096732.1.41871 WP_003096732.1.41888 WP_003096732.1.4190 WP_003096732.1.41939 WP_003096732.1.4196 WP_003096732.1.42 WP_003096732.1.42019 WP_003096732.1.42041 WP_003096732.1.42047 WP_003096732.1.42146 WP_003096732.1.42259 WP_003096732.1.42294 WP_003096732.1.42316 WP_003096732.1.42381 WP_003096732.1.42388 WP_003096732.1.42411 WP_003096732.1.42423 WP_003096732.1.42463 WP_003096732.1.42499 WP_003096732.1.42508 WP_003096732.1.42634 WP_003096732.1.42643 WP_003096732.1.42690 WP_003096732.1.42696 WP_003096732.1.42723 WP_003096732.1.4273 WP_003096732.1.42757 WP_003096732.1.42778 WP_003096732.1.42789 WP_003096732.1.42854 WP_003096732.1.42856 WP_003096732.1.42870 WP_003096732.1.42917 WP_003096732.1.42946 WP_003096732.1.42952 WP_003096732.1.42972 WP_003096732.1.42973 WP_003096732.1.43022 WP_003096732.1.43024 WP_003096732.1.43026 WP_003096732.1.43049 WP_003096732.1.43106 WP_003096732.1.43107 WP_003096732.1.43212 WP_003096732.1.43245 WP_003096732.1.43286 WP_003096732.1.43293 WP_003096732.1.43315 WP_003096732.1.43326 WP_003096732.1.43330 WP_003096732.1.43356 WP_003096732.1.4348 WP_003096732.1.43593 WP_003096732.1.43603 WP_003096732.1.43662 WP_003096732.1.43667 WP_003096732.1.43673 WP_003096732.1.43696 WP_003096732.1.43729 WP_003096732.1.43756 WP_003096732.1.43783 WP_003096732.1.43802 WP_003096732.1.4381 WP_003096732.1.43811 WP_003096732.1.43826 WP_003096732.1.4397 WP_003096732.1.4398 WP_003096732.1.43998 WP_003096732.1.44046 WP_003096732.1.44094 WP_003096732.1.44213 WP_003096732.1.44260 WP_003096732.1.44269 WP_003096732.1.44373 WP_003096732.1.44434 WP_003096732.1.44486 WP_003096732.1.445 WP_003096732.1.44552 WP_003096732.1.44563 WP_003096732.1.44565 WP_003096732.1.44581 WP_003096732.1.44725 WP_003096732.1.44739 WP_003096732.1.44760 WP_003096732.1.44804 WP_003096732.1.44870 WP_003096732.1.4493 WP_003096732.1.44959 WP_003096732.1.45063 WP_003096732.1.45090 WP_003096732.1.45146 WP_003096732.1.45199 WP_003096732.1.45202 WP_003096732.1.4522 WP_003096732.1.45298 WP_003096732.1.45306 WP_003096732.1.45312 WP_003096732.1.4532 WP_003096732.1.45328 WP_003096732.1.45353 WP_003096732.1.45358 WP_003096732.1.45464 WP_003096732.1.45478 WP_003096732.1.45485 WP_003096732.1.45604 WP_003096732.1.45611 WP_003096732.1.45635 WP_003096732.1.45636 WP_003096732.1.45678 WP_003096732.1.45700 WP_003096732.1.45711 WP_003096732.1.45723 WP_003096732.1.45818 WP_003096732.1.45837 WP_003096732.1.45920 WP_003096732.1.45934 WP_003096732.1.45946 WP_003096732.1.45961 WP_003096732.1.46032 WP_003096732.1.46093 WP_003096732.1.461 WP_003096732.1.46152 WP_003096732.1.46200 WP_003096732.1.46306 WP_003096732.1.4640 WP_003096732.1.46436 WP_003096732.1.46502 WP_003096732.1.46623 WP_003096732.1.46633 WP_003096732.1.46755 WP_003096732.1.46826 WP_003096732.1.46846 WP_003096732.1.46866 WP_003096732.1.46885 WP_003096732.1.46926 WP_003096732.1.46935 WP_003096732.1.4699 WP_003096732.1.47101 WP_003096732.1.47150 WP_003096732.1.47155 WP_003096732.1.47158 WP_003096732.1.47251 WP_003096732.1.4726 WP_003096732.1.47296 WP_003096732.1.47312 WP_003096732.1.47314 WP_003096732.1.47374 WP_003096732.1.47469 WP_003096732.1.47480 WP_003096732.1.47527 WP_003096732.1.47551 WP_003096732.1.47598 WP_003096732.1.47645 WP_003096732.1.47774 WP_003096732.1.47930 WP_003096732.1.47934 WP_003096732.1.47970 WP_003096732.1.48001 WP_003096732.1.48024 WP_003096732.1.48086 WP_003096732.1.48094 WP_003096732.1.48141 WP_003096732.1.48172 WP_003096732.1.48178 WP_003096732.1.48321 WP_003096732.1.48334 WP_003096732.1.4836 WP_003096732.1.48378 WP_003096732.1.48382 WP_003096732.1.48413 WP_003096732.1.48472 WP_003096732.1.48474 WP_003096732.1.48487 WP_003096732.1.48545 WP_003096732.1.48546 WP_003096732.1.48576 WP_003096732.1.48579 WP_003096732.1.48747 WP_003096732.1.48810 WP_003096732.1.48820 WP_003096732.1.48840 WP_003096732.1.48842 WP_003096732.1.48851 WP_003096732.1.48870 WP_003096732.1.48961 WP_003096732.1.48990 WP_003096732.1.49108 WP_003096732.1.4913 WP_003096732.1.49135 WP_003096732.1.49184 WP_003096732.1.49244 WP_003096732.1.49265 WP_003096732.1.49266 WP_003096732.1.49277 WP_003096732.1.49286 WP_003096732.1.49293 WP_003096732.1.49360 WP_003096732.1.49416 WP_003096732.1.49500 WP_003096732.1.49557 WP_003096732.1.49566 WP_003096732.1.49688 WP_003096732.1.49798 WP_003096732.1.49806 WP_003096732.1.49833 WP_003096732.1.49842 WP_003096732.1.49922 WP_003096732.1.49948 WP_003096732.1.49976 WP_003096732.1.49988 WP_003096732.1.49998 WP_003096732.1.50176 WP_003096732.1.50180 WP_003096732.1.50222 WP_003096732.1.50232 WP_003096732.1.50242 WP_003096732.1.5043 WP_003096732.1.50450 WP_003096732.1.50459 WP_003096732.1.50567 WP_003096732.1.50653 WP_003096732.1.50665 WP_003096732.1.50668 WP_003096732.1.50682 WP_003096732.1.50691 WP_003096732.1.50734 WP_003096732.1.50783 WP_003096732.1.50922 WP_003096732.1.50967 WP_003096732.1.50989 WP_003096732.1.51019 WP_003096732.1.51035 WP_003096732.1.51136 WP_003096732.1.51141 WP_003096732.1.51173 WP_003096732.1.51185 WP_003096732.1.51273 WP_003096732.1.5132 WP_003096732.1.51457 WP_003096732.1.51472 WP_003096732.1.51501 WP_003096732.1.51538 WP_003096732.1.51549 WP_003096732.1.51585 WP_003096732.1.51682 WP_003096732.1.51727 WP_003096732.1.51733 WP_003096732.1.51807 WP_003096732.1.51847 WP_003096732.1.51889 WP_003096732.1.51917 WP_003096732.1.51928 WP_003096732.1.51937 WP_003096732.1.51943 WP_003096732.1.51957 WP_003096732.1.51976 WP_003096732.1.52043 WP_003096732.1.52146 WP_003096732.1.52152 WP_003096732.1.52212 WP_003096732.1.52220 WP_003096732.1.52244 WP_003096732.1.5226 WP_003096732.1.52326 WP_003096732.1.52334 WP_003096732.1.5235 WP_003096732.1.52355 WP_003096732.1.52372 WP_003096732.1.52403 WP_003096732.1.52409 WP_003096732.1.52449 WP_003096732.1.52500 WP_003096732.1.52537 WP_003096732.1.5258 WP_003096732.1.52583 WP_003096732.1.52591 WP_003096732.1.5260 WP_003096732.1.52690 WP_003096732.1.52697 WP_003096732.1.52700 WP_003096732.1.52728 WP_003096732.1.52784 WP_003096732.1.52790 WP_003096732.1.52810 WP_003096732.1.52850 WP_003096732.1.52868 WP_003096732.1.5289 WP_003096732.1.52939 WP_003096732.1.5294 WP_003096732.1.53037 WP_003096732.1.53038 WP_003096732.1.53070 WP_003096732.1.53072 WP_003096732.1.53169 WP_003096732.1.53267 WP_003096732.1.53287 WP_003096732.1.53351 WP_003096732.1.53371 WP_003096732.1.53414 WP_003096732.1.53427 WP_003096732.1.53486 WP_003096732.1.53528 WP_003096732.1.53530 WP_003096732.1.53586 WP_003096732.1.53663 WP_003096732.1.53678 WP_003096732.1.53719 WP_003096732.1.53726 WP_003096732.1.53826 WP_003096732.1.5388 WP_003096732.1.53932 WP_003096732.1.53946 WP_003096732.1.53948 WP_003096732.1.53951 WP_003096732.1.5399 WP_003096732.1.54003 WP_003096732.1.54076 WP_003096732.1.54078 WP_003096732.1.54090 WP_003096732.1.54133 WP_003096732.1.54140 WP_003096732.1.54146 WP_003096732.1.5420 WP_003096732.1.54248 WP_003096732.1.5427 WP_003096732.1.54293 WP_003096732.1.54354 WP_003096732.1.54362 WP_003096732.1.54462 WP_003096732.1.54497 WP_003096732.1.54571 WP_003096732.1.54809 WP_003096732.1.54974 WP_003096732.1.55 WP_003096732.1.55089 WP_003096732.1.55169 WP_003096732.1.55245 WP_003096732.1.55347 WP_003096732.1.55387 WP_003096732.1.55400 WP_003096732.1.55445 WP_003096732.1.55478 WP_003096732.1.55543 WP_003096732.1.55729 WP_003096732.1.55765 WP_003096732.1.55813 WP_003096732.1.55976 WP_003096732.1.56013 WP_003096732.1.56037 WP_003096732.1.56145 WP_003096732.1.56171 WP_003096732.1.56187 WP_003096732.1.56188 WP_003096732.1.56196 WP_003096732.1.56228 WP_003096732.1.56229 WP_003096732.1.56315 WP_003096732.1.56348 WP_003096732.1.56442 WP_003096732.1.56452 WP_003096732.1.56465 WP_003096732.1.56474 WP_003096732.1.56475 WP_003096732.1.56623 WP_003096732.1.56626 WP_003096732.1.56632 WP_003096732.1.56745 WP_003096732.1.56768 WP_003096732.1.56797 WP_003096732.1.56808 WP_003096732.1.56819 WP_003096732.1.56837 WP_003096732.1.56850 WP_003096732.1.56864 WP_003096732.1.56896 WP_003096732.1.56943 WP_003096732.1.56973 WP_003096732.1.57020 WP_003096732.1.57065 WP_003096732.1.57113 WP_003096732.1.57131 WP_003096732.1.57140 WP_003096732.1.57276 WP_003096732.1.5731 WP_003096732.1.57339 WP_003096732.1.57369 WP_003096732.1.57417 WP_003096732.1.57460 WP_003096732.1.57477 WP_003096732.1.57480 WP_003096732.1.57532 WP_003096732.1.57548 WP_003096732.1.57728 WP_003096732.1.57792 WP_003096732.1.57839 WP_003096732.1.57841 WP_003096732.1.57853 WP_003096732.1.57921 WP_003096732.1.57966 WP_003096732.1.58019 WP_003096732.1.58056 WP_003096732.1.58155 WP_003096732.1.58162 WP_003096732.1.58183 WP_003096732.1.58193 WP_003096732.1.58200 WP_003096732.1.58228 WP_003096732.1.58294 WP_003096732.1.58360 WP_003096732.1.58417 WP_003096732.1.58436 WP_003096732.1.58482 WP_003096732.1.5850 WP_003096732.1.58510 WP_003096732.1.58527 WP_003096732.1.5856 WP_003096732.1.58581 WP_003096732.1.58689 WP_003096732.1.5869 WP_003096732.1.58785 WP_003096732.1.58800 WP_003096732.1.58838 WP_003096732.1.58845 WP_003096732.1.5889 WP_003096732.1.58944 WP_003096732.1.58952 WP_003096732.1.5897 WP_003096732.1.59013 WP_003096732.1.59076 WP_003096732.1.59099 WP_003096732.1.59123 WP_003096732.1.59156 WP_003096732.1.59158 WP_003096732.1.59176 WP_003096732.1.59212 WP_003096732.1.59246 WP_003096732.1.59249 WP_003096732.1.59250 WP_003096732.1.59288 WP_003096732.1.59339 WP_003096732.1.5937 WP_003096732.1.59376 WP_003096732.1.59385 WP_003096732.1.594 WP_003096732.1.59469 WP_003096732.1.59688 WP_003096732.1.59724 WP_003096732.1.59759 WP_003096732.1.59797 WP_003096732.1.59870 WP_003096732.1.59943 WP_003096732.1.60051 WP_003096732.1.60062 WP_003096732.1.60079 WP_003096732.1.60082 WP_003096732.1.60084 WP_003096732.1.60085 WP_003096732.1.60206 WP_003096732.1.60261 WP_003096732.1.60347 WP_003096732.1.60364 WP_003096732.1.60396 WP_003096732.1.60415 WP_003096732.1.60467 WP_003096732.1.60472 WP_003096732.1.60509 WP_003096732.1.60600 WP_003096732.1.60602 WP_003096732.1.60603 WP_003096732.1.60639 WP_003096732.1.60679 WP_003096732.1.60686 WP_003096732.1.607 WP_003096732.1.60850 WP_003096732.1.60910 WP_003096732.1.60916 WP_003096732.1.60970 WP_003096732.1.60979 WP_003096732.1.61122 WP_003096732.1.61130 WP_003096732.1.61191 WP_003096732.1.61209 WP_003096732.1.61222 WP_003096732.1.61269 WP_003096732.1.61288 WP_003096732.1.61294 WP_003096732.1.61299 WP_003096732.1.6130 WP_003096732.1.61366 WP_003096732.1.61431 WP_003096732.1.61493 WP_003096732.1.61549 WP_003096732.1.61589 WP_003096732.1.61598 WP_003096732.1.616 WP_003096732.1.61696 WP_003096732.1.6173 WP_003096732.1.61943 WP_003096732.1.62010 WP_003096732.1.62035 WP_003096732.1.62180 WP_003096732.1.62186 WP_003096732.1.62211 WP_003096732.1.62263 WP_003096732.1.62357 WP_003096732.1.62396 WP_003096732.1.62410 WP_003096732.1.6242 WP_003096732.1.62483 WP_003096732.1.6249 WP_003096732.1.62516 WP_003096732.1.62534 WP_003096732.1.626 WP_003096732.1.62604 WP_003096732.1.62635 WP_003096732.1.62688 WP_003096732.1.62701 WP_003096732.1.62703 WP_003096732.1.62708 WP_003096732.1.62716 WP_003096732.1.62768 WP_003096732.1.62772 WP_003096732.1.6280 WP_003096732.1.6283 WP_003096732.1.62834 WP_003096732.1.62838 WP_003096732.1.62873 WP_003096732.1.62917 WP_003096732.1.62961 WP_003096732.1.62977 WP_003096732.1.63038 WP_003096732.1.63041 WP_003096732.1.63057 WP_003096732.1.63124 WP_003096732.1.63193 WP_003096732.1.63196 WP_003096732.1.63338 WP_003096732.1.63369 WP_003096732.1.63401 WP_003096732.1.63591 WP_003096732.1.63597 WP_003096732.1.63659 WP_003096732.1.63739 WP_003096732.1.63784 WP_003096732.1.63929 WP_003096732.1.63941 WP_003096732.1.63989 WP_003096732.1.63995 WP_003096732.1.64139 WP_003096732.1.64155 WP_003096732.1.64198 WP_003096732.1.64212 WP_003096732.1.64309 WP_003096732.1.64329 WP_003096732.1.64340 WP_003096732.1.64433 WP_003096732.1.6450 WP_003096732.1.64544 WP_003096732.1.64591 WP_003096732.1.64603 WP_003096732.1.64605 WP_003096732.1.6461 WP_003096732.1.64611 WP_003096732.1.64726 WP_003096732.1.64748 WP_003096732.1.64799 WP_003096732.1.64807 WP_003096732.1.64854 WP_003096732.1.64862 WP_003096732.1.64880 WP_003096732.1.64885 WP_003096732.1.64886 WP_003096732.1.64983 WP_003096732.1.64984 WP_003096732.1.65009 WP_003096732.1.65066 WP_003096732.1.65092 WP_003096732.1.65095 WP_003096732.1.65099 WP_003096732.1.65145 WP_003096732.1.65196 WP_003096732.1.65197 WP_003096732.1.65227 WP_003096732.1.65237 WP_003096732.1.65247 WP_003096732.1.65285 WP_003096732.1.65304 WP_003096732.1.65312 WP_003096732.1.65316 WP_003096732.1.65334 WP_003096732.1.65335 WP_003096732.1.65337 WP_003096732.1.65457 WP_003096732.1.65478 WP_003096732.1.65549 WP_003096732.1.65588 WP_003096732.1.65632 WP_003096732.1.65642 WP_003096732.1.65679 WP_003096732.1.65740 WP_003096732.1.65819 WP_003096732.1.65867 WP_003096732.1.6589 WP_003096732.1.65926 WP_003096732.1.66062 WP_003096732.1.66088 WP_003096732.1.66155 WP_003096732.1.66165 WP_003096732.1.6627 WP_003096732.1.66277 WP_003096732.1.6629 WP_003096732.1.66345 WP_003096732.1.66348 WP_003096732.1.66364 WP_003096732.1.66371 WP_003096732.1.66410 WP_003096732.1.66526 WP_003096732.1.66563 WP_003096732.1.66584 WP_003096732.1.66693 WP_003096732.1.66721 WP_003096732.1.66892 WP_003096732.1.66929 WP_003096732.1.66931 WP_003096732.1.66945 WP_003096732.1.66950 WP_003096732.1.66982 WP_003096732.1.67010 WP_003096732.1.67124 WP_003096732.1.67188 WP_003096732.1.67192 WP_003096732.1.67205 WP_003096732.1.67261 WP_003096732.1.67269 WP_003096732.1.6734 WP_003096732.1.67370 WP_003096732.1.67388 WP_003096732.1.67472 WP_003096732.1.67489 WP_003096732.1.67506 WP_003096732.1.67526 WP_003096732.1.67531 WP_003096732.1.67545 WP_003096732.1.6768 WP_003096732.1.67686 WP_003096732.1.67755 WP_003096732.1.67830 WP_003096732.1.67874 WP_003096732.1.67875 WP_003096732.1.67899 WP_003096732.1.67903 WP_003096732.1.67937 WP_003096732.1.67948 WP_003096732.1.6796 WP_003096732.1.68000 WP_003096732.1.6808 WP_003096732.1.68162 WP_003096732.1.68172 WP_003096732.1.68194 WP_003096732.1.68252 WP_003096732.1.68317 WP_003096732.1.68446 WP_003096732.1.68448 WP_003096732.1.68472 WP_003096732.1.68499 WP_003096732.1.6850 WP_003096732.1.68541 WP_003096732.1.68561 WP_003096732.1.68568 WP_003096732.1.68638 WP_003096732.1.6866 WP_003096732.1.68756 WP_003096732.1.68781 WP_003096732.1.68790 WP_003096732.1.68800 WP_003096732.1.68802 WP_003096732.1.68850 WP_003096732.1.68857 WP_003096732.1.68862 WP_003096732.1.68881 WP_003096732.1.68910 WP_003096732.1.68938 WP_003096732.1.68979 WP_003096732.1.69088 WP_003096732.1.6911 WP_003096732.1.69159 WP_003096732.1.69209 WP_003096732.1.69260 WP_003096732.1.6928 WP_003096732.1.6931 WP_003096732.1.69330 WP_003096732.1.6937 WP_003096732.1.69411 WP_003096732.1.69534 WP_003096732.1.69556 WP_003096732.1.69599 WP_003096732.1.69702 WP_003096732.1.69788 WP_003096732.1.69791 WP_003096732.1.69819 WP_003096732.1.69834 WP_003096732.1.69907 WP_003096732.1.69993 WP_003096732.1.70092 WP_003096732.1.70098 WP_003096732.1.70138 WP_003096732.1.70168 WP_003096732.1.70194 WP_003096732.1.70216 WP_003096732.1.70229 WP_003096732.1.70331 WP_003096732.1.70460 WP_003096732.1.70470 WP_003096732.1.70537 WP_003096732.1.70561 WP_003096732.1.70583 WP_003096732.1.70650 WP_003096732.1.70677 WP_003096732.1.70693 WP_003096732.1.7077 WP_003096732.1.70778 WP_003096732.1.70831 WP_003096732.1.70991 WP_003096732.1.71038 WP_003096732.1.71141 WP_003096732.1.71203 WP_003096732.1.71234 WP_003096732.1.71249 WP_003096732.1.71254 WP_003096732.1.7128 WP_003096732.1.71290 WP_003096732.1.71346 WP_003096732.1.71412 WP_003096732.1.71570 WP_003096732.1.71610 WP_003096732.1.7163 WP_003096732.1.71642 WP_003096732.1.71666 WP_003096732.1.71738 WP_003096732.1.71799 WP_003096732.1.71806 WP_003096732.1.71822 WP_003096732.1.71862 WP_003096732.1.71866 WP_003096732.1.71891 WP_003096732.1.71927 WP_003096732.1.71934 WP_003096732.1.72149 WP_003096732.1.72167 WP_003096732.1.72181 WP_003096732.1.72183 WP_003096732.1.7219 WP_003096732.1.72287 WP_003096732.1.72331 WP_003096732.1.72346 WP_003096732.1.72378 WP_003096732.1.72447 WP_003096732.1.72458 WP_003096732.1.72477 WP_003096732.1.72541 WP_003096732.1.72562 WP_003096732.1.72570 WP_003096732.1.72653 WP_003096732.1.72662 WP_003096732.1.72669 WP_003096732.1.72727 WP_003096732.1.7276 WP_003096732.1.72768 WP_003096732.1.72772 WP_003096732.1.72782 WP_003096732.1.72845 WP_003096732.1.72920 WP_003096732.1.73035 WP_003096732.1.73048 WP_003096732.1.7308 WP_003096732.1.73135 WP_003096732.1.73149 WP_003096732.1.73172 WP_003096732.1.73192 WP_003096732.1.7327 WP_003096732.1.7329 WP_003096732.1.733 WP_003096732.1.73455 WP_003096732.1.73490 WP_003096732.1.73523 WP_003096732.1.73541 WP_003096732.1.73601 WP_003096732.1.73609 WP_003096732.1.73651 WP_003096732.1.73719 WP_003096732.1.73728 WP_003096732.1.7377 WP_003096732.1.73791 WP_003096732.1.7382 WP_003096732.1.73860 WP_003096732.1.73889 WP_003096732.1.73911 WP_003096732.1.73941 WP_003096732.1.74 WP_003096732.1.74000 WP_003096732.1.74072 WP_003096732.1.74074 WP_003096732.1.7408 WP_003096732.1.74106 WP_003096732.1.74175 WP_003096732.1.74180 WP_003096732.1.74182 WP_003096732.1.74219 WP_003096732.1.74264 WP_003096732.1.74268 WP_003096732.1.74281 WP_003096732.1.74287 WP_003096732.1.74326 WP_003096732.1.7445 WP_003096732.1.74458 WP_003096732.1.74473 WP_003096732.1.74475 WP_003096732.1.7448 WP_003096732.1.74518 WP_003096732.1.7456 WP_003096732.1.74568 WP_003096732.1.74604 WP_003096732.1.74629 WP_003096732.1.74637 WP_003096732.1.74685 WP_003096732.1.74772 WP_003096732.1.74776 WP_003096732.1.748 WP_003096732.1.74878 WP_003096732.1.74941 WP_003096732.1.74948 WP_003096732.1.74958 WP_003096732.1.7501 WP_003096732.1.75119 WP_003096732.1.75204 WP_003096732.1.75277 WP_003096732.1.75303 WP_003096732.1.75389 WP_003096732.1.75431 WP_003096732.1.7547 WP_003096732.1.75549 WP_003096732.1.75573 WP_003096732.1.75580 WP_003096732.1.75599 WP_003096732.1.75603 WP_003096732.1.75631 WP_003096732.1.7568 WP_003096732.1.75756 WP_003096732.1.75771 WP_003096732.1.75792 WP_003096732.1.75825 WP_003096732.1.75826 WP_003096732.1.75860 WP_003096732.1.75935 WP_003096732.1.75938 WP_003096732.1.75947 WP_003096732.1.7595 WP_003096732.1.76077 WP_003096732.1.76092 WP_003096732.1.76141 WP_003096732.1.76145 WP_003096732.1.76192 WP_003096732.1.76322 WP_003096732.1.76355 WP_003096732.1.76383 WP_003096732.1.76399 WP_003096732.1.76441 WP_003096732.1.76467 WP_003096732.1.76484 WP_003096732.1.76543 WP_003096732.1.76600 WP_003096732.1.76633 WP_003096732.1.7666 WP_003096732.1.76716 WP_003096732.1.76775 WP_003096732.1.76791 WP_003096732.1.76861 WP_003096732.1.76922 WP_003096732.1.76985 WP_003096732.1.77235 WP_003096732.1.77238 WP_003096732.1.77286 WP_003096732.1.77317 WP_003096732.1.77442 WP_003096732.1.77476 WP_003096732.1.77490 WP_003096732.1.77566 WP_003096732.1.77574 WP_003096732.1.77587 WP_003096732.1.77686 WP_003096732.1.77769 WP_003096732.1.7779 WP_003096732.1.77819 WP_003096732.1.77834 WP_003096732.1.77913 WP_003096732.1.78104 WP_003096732.1.78112 WP_003096732.1.78118 WP_003096732.1.78134 WP_003096732.1.78148 WP_003096732.1.78158 WP_003096732.1.78280 WP_003096732.1.78288 WP_003096732.1.78380 WP_003096732.1.7840 WP_003096732.1.78409 WP_003096732.1.78425 WP_003096732.1.78430 WP_003096732.1.78437 WP_003096732.1.78570 WP_003096732.1.78599 WP_003096732.1.78623 WP_003096732.1.78669 WP_003096732.1.78693 WP_003096732.1.78795 WP_003096732.1.788 WP_003096732.1.78810 WP_003096732.1.78926 WP_003096732.1.78947 WP_003096732.1.78954 WP_003096732.1.78986 WP_003096732.1.7899 WP_003096732.1.79003 WP_003096732.1.79007 WP_003096732.1.79053 WP_003096732.1.79060 WP_003096732.1.79177 WP_003096732.1.79193 WP_003096732.1.79256 WP_003096732.1.79279 WP_003096732.1.79286 WP_003096732.1.79311 WP_003096732.1.79357 WP_003096732.1.79364 WP_003096732.1.79421 WP_003096732.1.79429 WP_003096732.1.79431 WP_003096732.1.7945 WP_003096732.1.79463 WP_003096732.1.79507 WP_003096732.1.7953 WP_003096732.1.79544 WP_003096732.1.79569 WP_003096732.1.79601 WP_003096732.1.79631 WP_003096732.1.79699 WP_003096732.1.79754 WP_003096732.1.79788 WP_003096732.1.79862 WP_003096732.1.79883 WP_003096732.1.799 WP_003096732.1.79902 WP_003096732.1.79908 WP_003096732.1.79986 WP_003096732.1.8 WP_003096732.1.80033 WP_003096732.1.80068 WP_003096732.1.80087 WP_003096732.1.80102 WP_003096732.1.8013 WP_003096732.1.80174 WP_003096732.1.80258 WP_003096732.1.8028 WP_003096732.1.80306 WP_003096732.1.8038 WP_003096732.1.80410 WP_003096732.1.80411 WP_003096732.1.80454 WP_003096732.1.80481 WP_003096732.1.8051 WP_003096732.1.80535 WP_003096732.1.80572 WP_003096732.1.80627 WP_003096732.1.80632 WP_003096732.1.8064 WP_003096732.1.80644 WP_003096732.1.80645 WP_003096732.1.80683 WP_003096732.1.80715 WP_003096732.1.80720 WP_003096732.1.80785 WP_003096732.1.80846 WP_003096732.1.80892 WP_003096732.1.80910 WP_003096732.1.80926 WP_003096732.1.80929 WP_003096732.1.80931 WP_003096732.1.80938 WP_003096732.1.80969 WP_003096732.1.81081 WP_003096732.1.81082 WP_003096732.1.8110 WP_003096732.1.81206 WP_003096732.1.81237 WP_003096732.1.81331 WP_003096732.1.81338 WP_003096732.1.81349 WP_003096732.1.81368 WP_003096732.1.81380 WP_003096732.1.8141 WP_003096732.1.81426 WP_003096732.1.81470 WP_003096732.1.81482 WP_003096732.1.81487 WP_003096732.1.81581 WP_003096732.1.81591 WP_003096732.1.81622 WP_003096732.1.81643 WP_003096732.1.81708 WP_003096732.1.81728 WP_003096732.1.81742 WP_003096732.1.81748 WP_003096732.1.81771 WP_003096732.1.81784 WP_003096732.1.81802 WP_003096732.1.81816 WP_003096732.1.81834 WP_003096732.1.81844 WP_003096732.1.81856 WP_003096732.1.81874 WP_003096732.1.81927 WP_003096732.1.81950 WP_003096732.1.81957 WP_003096732.1.81960 WP_003096732.1.81986 WP_003096732.1.82127 WP_003096732.1.82178 WP_003096732.1.82260 WP_003096732.1.8227 WP_003096732.1.82310 WP_003096732.1.82312 WP_003096732.1.82328 WP_003096732.1.82334 WP_003096732.1.8238 WP_003096732.1.82442 WP_003096732.1.82487 WP_003096732.1.82580 WP_003096732.1.82604 WP_003096732.1.82606 WP_003096732.1.82620 WP_003096732.1.82643 WP_003096732.1.82686 WP_003096732.1.82710 WP_003096732.1.82798 WP_003096732.1.82810 WP_003096732.1.8284 WP_003096732.1.82864 WP_003096732.1.82882 WP_003096732.1.82887 WP_003096732.1.82936 WP_003096732.1.83025 WP_003096732.1.83131 WP_003096732.1.83184 WP_003096732.1.83213 WP_003096732.1.83251 WP_003096732.1.83267 WP_003096732.1.83296 WP_003096732.1.83317 WP_003096732.1.83374 WP_003096732.1.83394 WP_003096732.1.83440 WP_003096732.1.83460 WP_003096732.1.83463 WP_003096732.1.835 WP_003096732.1.83503 WP_003096732.1.8351 WP_003096732.1.8353 WP_003096732.1.83534 WP_003096732.1.83540 WP_003096732.1.8357 WP_003096732.1.83637 WP_003096732.1.83673 WP_003096732.1.83698 WP_003096732.1.83715 WP_003096732.1.83871 WP_003096732.1.83937 WP_003096732.1.83946 WP_003096732.1.84003 WP_003096732.1.84008 WP_003096732.1.84138 WP_003096732.1.84162 WP_003096732.1.84174 WP_003096732.1.84177 WP_003096732.1.84178 WP_003096732.1.84190 WP_003096732.1.84203 WP_003096732.1.84271 WP_003096732.1.84297 WP_003096732.1.8437 WP_003096732.1.84374 WP_003096732.1.84398 WP_003096732.1.84404 WP_003096732.1.84439 WP_003096732.1.84471 WP_003096732.1.84487 WP_003096732.1.84526 WP_003096732.1.8453 WP_003096732.1.84538 WP_003096732.1.84558 WP_003096732.1.84589 WP_003096732.1.84674 WP_003096732.1.84684 WP_003096732.1.84702 WP_003096732.1.84715 WP_003096732.1.84754 WP_003096732.1.84792 WP_003096732.1.84825 WP_003096732.1.8484 WP_003096732.1.84865 WP_003096732.1.84917 WP_003096732.1.84937 WP_003096732.1.84946 WP_003096732.1.8498 WP_003096732.1.85018 WP_003096732.1.85028 WP_003096732.1.85059 WP_003096732.1.85150 WP_003096732.1.85220 WP_003096732.1.85290 WP_003096732.1.85298 WP_003096732.1.85303 WP_003096732.1.85311 WP_003096732.1.85318 WP_003096732.1.85357 WP_003096732.1.85446 WP_003096732.1.85453 WP_003096732.1.85574 WP_003096732.1.85633 WP_003096732.1.85638 WP_003096732.1.85788 WP_003096732.1.85897 WP_003096732.1.85910 WP_003096732.1.85920 WP_003096732.1.85978 WP_003096732.1.86002 WP_003096732.1.86047 WP_003096732.1.86055 WP_003096732.1.86058 WP_003096732.1.861 WP_003096732.1.86125 WP_003096732.1.86182 WP_003096732.1.86243 WP_003096732.1.86278 WP_003096732.1.86287 WP_003096732.1.86293 WP_003096732.1.86386 WP_003096732.1.86432 WP_003096732.1.8645 WP_003096732.1.865 WP_003096732.1.86506 WP_003096732.1.86545 WP_003096732.1.86552 WP_003096732.1.86554 WP_003096732.1.86595 WP_003096732.1.86652 WP_003096732.1.86660 WP_003096732.1.86665 WP_003096732.1.867 WP_003096732.1.86708 WP_003096732.1.86733 WP_003096732.1.86774 WP_003096732.1.86780 WP_003096732.1.86785 WP_003096732.1.86796 WP_003096732.1.86813 WP_003096732.1.86822 WP_003096732.1.8693 WP_003096732.1.86947 WP_003096732.1.86970 WP_003096732.1.86985 WP_003096732.1.87104 WP_003096732.1.87163 WP_003096732.1.8718 WP_003096732.1.87182 WP_003096732.1.87183 WP_003096732.1.8727 WP_003096732.1.87316 WP_003096732.1.87390 WP_003096732.1.87435 WP_003096732.1.87463 WP_003096732.1.8749 WP_003096732.1.87530 WP_003096732.1.87547 WP_003096732.1.87648 WP_003096732.1.87763 WP_003096732.1.8777 WP_003096732.1.8785 WP_003096732.1.87877 WP_003096732.1.87888 WP_003096732.1.87970 WP_003096732.1.87975 WP_003096732.1.87981 WP_003096732.1.87987 WP_003096732.1.88004 WP_003096732.1.88152 WP_003096732.1.88308 WP_003096732.1.88330 WP_003096732.1.88360 WP_003096732.1.88388 WP_003096732.1.88415 WP_003096732.1.88517 WP_003096732.1.8852 WP_003096732.1.88540 WP_003096732.1.88550 WP_003096732.1.88578 WP_003096732.1.88659 WP_003096732.1.88679 WP_003096732.1.88680 WP_003096732.1.88714 WP_003096732.1.88750 WP_003096732.1.88796 WP_003096732.1.889 WP_003096732.1.88900 WP_003096732.1.88949 WP_003096732.1.88969 WP_003096732.1.89083 WP_003096732.1.89098 WP_003096732.1.8911 WP_003096732.1.89234 WP_003096732.1.89245 WP_003096732.1.89266 WP_003096732.1.89276 WP_003096732.1.89330 WP_003096732.1.89409 WP_003096732.1.89434 WP_003096732.1.89440 WP_003096732.1.89480 WP_003096732.1.8949 WP_003096732.1.89491 WP_003096732.1.89523 WP_003096732.1.89577 WP_003096732.1.89610 WP_003096732.1.89638 WP_003096732.1.89662 WP_003096732.1.89669 WP_003096732.1.89736 WP_003096732.1.8976 WP_003096732.1.89776 WP_003096732.1.89805 WP_003096732.1.89866 WP_003096732.1.89867 WP_003096732.1.89868 WP_003096732.1.89871 WP_003096732.1.89886 WP_003096732.1.89992 WP_003096732.1.90024 WP_003096732.1.90032 WP_003096732.1.90056 WP_003096732.1.90110 WP_003096732.1.90141 WP_003096732.1.90150 WP_003096732.1.90189 WP_003096732.1.90224 WP_003096732.1.90225 WP_003096732.1.90242 WP_003096732.1.90268 WP_003096732.1.90272 WP_003096732.1.90306 WP_003096732.1.90412 WP_003096732.1.9056 WP_003096732.1.90569 WP_003096732.1.90655 WP_003096732.1.90770 WP_003096732.1.90922 WP_003096732.1.90940 WP_003096732.1.90999 WP_003096732.1.91012 WP_003096732.1.91093 WP_003096732.1.91161 WP_003096732.1.9120 WP_003096732.1.91204 WP_003096732.1.91236 WP_003096732.1.91281 WP_003096732.1.91307 WP_003096732.1.91336 WP_003096732.1.91360 WP_003096732.1.91392 WP_003096732.1.91416 WP_003096732.1.9143 WP_003096732.1.91431 WP_003096732.1.91438 WP_003096732.1.91467 WP_003096732.1.91527 WP_003096732.1.91563 WP_003096732.1.91585 WP_003096732.1.91796 WP_003096732.1.91803 WP_003096732.1.9182 WP_003096732.1.91838 WP_003096732.1.91846 WP_003096732.1.91860 WP_003096732.1.91862 WP_003096732.1.91882 WP_003096732.1.9191 WP_003096732.1.91938 WP_003096732.1.91943 WP_003096732.1.91996 WP_003096732.1.92043 WP_003096732.1.92175 WP_003096732.1.9219 WP_003096732.1.92314 WP_003096732.1.92321 WP_003096732.1.92357 WP_003096732.1.92454 WP_003096732.1.92573 WP_003096732.1.92585 WP_003096732.1.92587 WP_003096732.1.92589 WP_003096732.1.92594 WP_003096732.1.92624 WP_003096732.1.92630 WP_003096732.1.92642 WP_003096732.1.9272 WP_003096732.1.92759 WP_003096732.1.92769 WP_003096732.1.92839 WP_003096732.1.92847 WP_003096732.1.92894 WP_003096732.1.92924 WP_003096732.1.92930 WP_003096732.1.92974 WP_003096732.1.93001 WP_003096732.1.93090 WP_003096732.1.93122 WP_003096732.1.93130 WP_003096732.1.93144 WP_003096732.1.93148 WP_003096732.1.93196 WP_003096732.1.93250 WP_003096732.1.93264 WP_003096732.1.9328 WP_003096732.1.93446 WP_003096732.1.9349 WP_003096732.1.93493 WP_003096732.1.93520 WP_003096732.1.93547 WP_003096732.1.93562 WP_003096732.1.93568 WP_003096732.1.93797 WP_003096732.1.93848 WP_003096732.1.93889 WP_003096732.1.93897 WP_003096732.1.94004 WP_003096732.1.94031 WP_003096732.1.94065 WP_003096732.1.94078 WP_003096732.1.94136 WP_003096732.1.94174 WP_003096732.1.94211 WP_003096732.1.94218 WP_003096732.1.94221 WP_003096732.1.94230 WP_003096732.1.94243 WP_003096732.1.94285 WP_003096732.1.94288 WP_003096732.1.94333 WP_003096732.1.94349 WP_003096732.1.94385 WP_003096732.1.94422 WP_003096732.1.94434 WP_003096732.1.9444 WP_003096732.1.94450 WP_003096732.1.94682 WP_003096732.1.94732 WP_003096732.1.94742 WP_003096732.1.94814 WP_003096732.1.94818 WP_003096732.1.94874 WP_003096732.1.94881 WP_003096732.1.94896 WP_003096732.1.94897 WP_003096732.1.94943 WP_003096732.1.95018 WP_003096732.1.95025 WP_003096732.1.95027 WP_003096732.1.95056 WP_003096732.1.95117 WP_003096732.1.95132 WP_003096732.1.95187 WP_003096732.1.95207 WP_003096732.1.95217 WP_003096732.1.95305 WP_003096732.1.95324 WP_003096732.1.95354 WP_003096732.1.95359 WP_003096732.1.95460 WP_003096732.1.95488 WP_003096732.1.95525 WP_003096732.1.95536 WP_003096732.1.95638 WP_003096732.1.95668 WP_003096732.1.95745 WP_003096732.1.95751 WP_003096732.1.95782 WP_003096732.1.95787 WP_003096732.1.95802 WP_003096732.1.95820 WP_003096732.1.95825 WP_003096732.1.95959 WP_003096732.1.9599 WP_003096732.1.95999 WP_003096732.1.96008 WP_003096732.1.9604 WP_003096732.1.96041 WP_003096732.1.96058 WP_003096732.1.961 WP_003096732.1.96134 WP_003096732.1.96193 WP_003096732.1.96243 WP_003096732.1.96267 WP_003096732.1.96357 WP_003096732.1.96384 WP_003096732.1.96434 WP_003096732.1.96452 WP_003096732.1.96506 WP_003096732.1.96667 WP_003096732.1.96702 WP_003096732.1.96714 WP_003096732.1.96863 WP_003096732.1.96880 WP_003096732.1.96967 WP_003096732.1.9706 WP_003096732.1.97118 WP_003096732.1.97126 WP_003096732.1.97204 WP_003096732.1.97213 WP_003096732.1.9722 WP_003096732.1.97271 WP_003096732.1.97377 WP_003096732.1.97461 WP_003096732.1.97474 WP_003096732.1.97488 WP_003096732.1.97499 WP_003096732.1.97503 WP_003096732.1.97521 WP_003096732.1.97583 WP_003096732.1.97614 WP_003096732.1.977 WP_003096732.1.97784 WP_003096732.1.97826 WP_003096732.1.97877 WP_003096732.1.97968 WP_003096732.1.98111 WP_003096732.1.98260 WP_003096732.1.98276 WP_003096732.1.98308 WP_003096732.1.98410 WP_003096732.1.98414 WP_003096732.1.98433 WP_003096732.1.9845 WP_003096732.1.985 WP_003096732.1.98515 WP_003096732.1.98522 WP_003096732.1.98573 WP_003096732.1.98600 WP_003096732.1.98610 WP_003096732.1.98672 WP_003096732.1.98678 WP_003096732.1.98693 WP_003096732.1.98718 WP_003096732.1.98788 WP_003096732.1.98814 WP_003096732.1.9885 WP_003096732.1.98873 WP_003096732.1.98907 WP_003096732.1.98926 WP_003096732.1.98958 WP_003096732.1.98960 WP_003096732.1.98963 WP_003096732.1.99065 WP_003096732.1.99103 WP_003096732.1.99214 WP_003096732.1.99293 WP_003096732.1.99353 WP_003096732.1.99378 WP_003096732.1.99386 WP_003096732.1.99389 WP_003096732.1.99443 WP_003096732.1.99461 WP_003096732.1.9951 WP_003096732.1.99516 WP_003096732.1.99647 WP_003096732.1.99654 WP_003096732.1.99662 WP_003096732.1.99746 WP_003096732.1.99757 WP_003096732.1.99772 WP_003096732.1.99795 WP_003096732.1.99835 WP_003096732.1.9989 WP_003096732.1.99930 gi|218894496|ref|YP_002443366.1| gi|392987115|ref|YP_006485702.1| gi|514412495|ref|YP_008136051.1| gi|558669229|ref|YP_008805939.1| 208963.PA14_71200 208964.PA5392 381754.PSPA7_6178 557722.PLES_57881 gi|568156922|ref|YP_008945915.1| gi|116053539|ref|YP_793866.1| gi|478481851|ref|YP_007712502.1| gi|564955785|ref|YP_008888355.1| gi|15600585|ref|NP_254079.1| gi|386069050|ref|YP_005984354.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]