SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|148826764|ref|YP_001291517.1| from Haemophilus influenzae PittGG

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|148826764|ref|YP_001291517.1|
Domain Number 1 Region: 10-236
Classification Level Classification E-value
Superfamily PLP-binding barrel 4.19e-66
Family Alanine racemase-like, N-terminal domain 0.00000722
Further Details:      
 
Domain Number 2 Region: 230-359
Classification Level Classification E-value
Superfamily Alanine racemase C-terminal domain-like 8.72e-43
Family Alanine racemase 0.0000614
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|148826764|ref|YP_001291517.1|
Sequence length 360
Comment alanine racemase [Haemophilus influenzae PittGG]
Sequence
MNVKPATAKISSHALKQNLEIIKQKAPNSKIIAVVKANAYGHGVVFVASTLEQNVDCFGV
ARLEEALALRSNGITKPILLLEGFFNEQDLPILAVNNIETVVHNHEQLEALKRSNLPSPI
KVWLKIDTGMHRLGVALDEVDYFYQELKKLPQIQPHLGFVSHFSRADELESDYTQLQINR
FLSATKDKQGERTIAASGGILFWPKSHLECIRPGIIMYGISPTNTIGKEFGLTPVMNLTS
SLIAVRHHKQGDPVGYGGIWTSPRDTKIGVVAMGYGDGYPRDVPEGTPVYLNGRLVPIVG
RVSMDMLTVDLGADSQDLVGDEVILWGKELPIETVAKFTGILSYELITKLTPRVITEYVD
Download sequence
Identical sequences A0A1Q5Y2P8 A5UED3
gi|148826764|ref|YP_001291517.1| 374931.CGSHiGG_00040 WP_011961982.1.45125

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]