SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|148826765|ref|YP_001291518.1| from Haemophilus influenzae PittGG

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|148826765|ref|YP_001291518.1|
Domain Number 1 Region: 4-79,171-345
Classification Level Classification E-value
Superfamily Phosphoenolpyruvate/pyruvate domain 3.84e-87
Family Pyruvate kinase 0.00000399
Further Details:      
 
Domain Number 2 Region: 329-477
Classification Level Classification E-value
Superfamily PK C-terminal domain-like 1.25e-33
Family Pyruvate kinase, C-terminal domain 0.0015
Further Details:      
 
Domain Number 3 Region: 74-168
Classification Level Classification E-value
Superfamily PK beta-barrel domain-like 6.11e-25
Family Pyruvate kinase beta-barrel domain 0.00085
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|148826765|ref|YP_001291518.1|
Sequence length 478
Comment pyruvate kinase [Haemophilus influenzae PittGG]
Sequence
MSRRLRRTKIVCTMGPSTDRDNNLEKIIAAGANVVRMNFSHGTPDDHIGRAERVRSIAKK
LGKTVAILGDLQGPKIRVSTFKDGKIFLNIGDKFILDAELPKGEGTQESVGLDYKTLPQD
VVPGDILLLDDGRVQLKVLSTDGAKVFTEVTVGGPLSNNKGINKLGGGLSADALTEKDKA
DIITAARIGVDFLAVSFPRSSADLNYARELAQQAGLNAKIVAKVERAETVANDEAMDDII
LASDVIMVARGDLGVEIGDPELVGVQKKLIRRSRQLNRAVITATQMMESMISNPMPTRAE
VMDVANAVLDGTDAVMLSAETAAGQYPSETVAAMASVCLGAEKMPSINVSRHRMDKEFET
IEESVAMSAMYAANHMKGVAAIVTLTSTGRTPLLMSRISSGLPIFALSRNQETLNLCALY
RGVTPIYHGEESRTEAGAKAALQSLKEKGYLSTGDLVLVTQGGQGATQTNVCRTLIVE
Download sequence
Identical sequences A0A0D0INH3 A5UED4
gi|148826765|ref|YP_001291518.1| WP_005665278.1.25413 WP_005665278.1.40038 WP_005665278.1.40503 WP_005665278.1.45125 WP_005665278.1.51509 WP_005665278.1.55069 WP_005665278.1.56181 WP_005665278.1.8638 374931.CGSHiGG_00060

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]