SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|148826783|ref|YP_001291536.1| from Haemophilus influenzae PittGG

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|148826783|ref|YP_001291536.1|
Domain Number 1 Region: 13-354
Classification Level Classification E-value
Superfamily Release factor 4.19e-142
Family Release factor 0.000000000115
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|148826783|ref|YP_001291536.1|
Sequence length 361
Comment peptide chain release factor 1 [Haemophilus influenzae PittGG]
Sequence
MMKDSIIAKLESLKERYEELEALLGDVSVISDQDKFRAYSKEYSQLEEVVKCFNRWTQLN
QNIEEAEILLDDPEMKEMAQMEIEESKAEIEEVEQQLQILLLPKDPNDEYNCYLEIRAGT
GGDEAGIFAGDLFRMYSRYAESKRWRVEMLSANESEQGGYKEVIVKVSGEGVYGQLKFES
GGHRVQRVPKTESQGRIHTSACTVAVMPELPESEMPEINPADLRIDTYRSSGAGGQHVNT
TDSAVRITHIPTGIVVECQDERSQHKNKAKAMSVLASRIVQAEQERQAAEQTDMRRNLLG
SGDRSDKIRTYNYPQGRVTDHRINLTIYRLDEVMNGKIDELIQPIITEYQADQLAALSEQ
N
Download sequence
Identical sequences A5UEF2
374931.CGSHiGG_00150 WP_011962000.1.3733 WP_011962000.1.45125 WP_011962000.1.51509 WP_011962000.1.76422 WP_011962000.1.98200 gi|148826783|ref|YP_001291536.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]