SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|148826890|ref|YP_001291643.1| from Haemophilus influenzae PittGG

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|148826890|ref|YP_001291643.1|
Domain Number 1 Region: 36-90
Classification Level Classification E-value
Superfamily lambda repressor-like DNA-binding domains 0.00000000000147
Family Phage repressors 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|148826890|ref|YP_001291643.1|
Sequence length 92
Comment hypothetical protein CGSHiGG_00820 [Haemophilus influenzae PittGG]
Sequence
MNHLLTFYEKIIFTNPLETGIPEAVAKLALLNDYSALRAWREHLGLTQAEVASRLGISQA
AYSQHENSQTLRKSTRIKIATALGINSAQLDF
Download sequence
Identical sequences A0A1Q5Y2G1 A5UEQ4 Q4QKC1
281310.NTHI1739 374931.CGSHiGG_00820 gi|68250074|ref|YP_249186.1| WP_011272618.1.10621 WP_011272618.1.15261 WP_011272618.1.17459 WP_011272618.1.23065 WP_011272618.1.23149 WP_011272618.1.23920 WP_011272618.1.25656 WP_011272618.1.27712 WP_011272618.1.28397 WP_011272618.1.32618 WP_011272618.1.37003 WP_011272618.1.38938 WP_011272618.1.39279 WP_011272618.1.40343 WP_011272618.1.40942 WP_011272618.1.42240 WP_011272618.1.44893 WP_011272618.1.45125 WP_011272618.1.4569 WP_011272618.1.50588 WP_011272618.1.50795 WP_011272618.1.53947 WP_011272618.1.54653 WP_011272618.1.56005 WP_011272618.1.61426 WP_011272618.1.62697 WP_011272618.1.63539 WP_011272618.1.74240 WP_011272618.1.74810 WP_011272618.1.76348 WP_011272618.1.79255 WP_011272618.1.79564 WP_011272618.1.79785 WP_011272618.1.8829 WP_011272618.1.90320 WP_011272618.1.91188 WP_011272618.1.91769 WP_011272618.1.97721 gi|148826890|ref|YP_001291643.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]