SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|148826909|ref|YP_001291662.1| from Haemophilus influenzae PittGG

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|148826909|ref|YP_001291662.1|
Domain Number 1 Region: 3-61
Classification Level Classification E-value
Superfamily lambda repressor-like DNA-binding domains 8.44e-17
Family Phage repressors 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|148826909|ref|YP_001291662.1|
Sequence length 62
Comment hypothetical protein CGSHiGG_00915 [Haemophilus influenzae PittGG]
Sequence
MLPIEKAYEIVGGISAMARHFNLTPWAVSKWREKVPAERCAKIEELTDGKVKKSELRPDL
WD
Download sequence
Identical sequences A0A0E1SNM5 A0A1Q5Y2B3 A4N045 A5UES3 Q4QKD8
281310.NTHI1721 374931.CGSHiGG_00915 WP_005650512.1.10621 WP_005650512.1.12329 WP_005650512.1.15261 WP_005650512.1.20018 WP_005650512.1.20853 WP_005650512.1.23065 WP_005650512.1.23149 WP_005650512.1.23920 WP_005650512.1.25656 WP_005650512.1.27712 WP_005650512.1.28397 WP_005650512.1.32618 WP_005650512.1.37003 WP_005650512.1.38938 WP_005650512.1.39279 WP_005650512.1.40040 WP_005650512.1.40343 WP_005650512.1.40503 WP_005650512.1.40942 WP_005650512.1.42240 WP_005650512.1.43923 WP_005650512.1.44893 WP_005650512.1.45125 WP_005650512.1.4569 WP_005650512.1.50588 WP_005650512.1.50795 WP_005650512.1.54653 WP_005650512.1.61426 WP_005650512.1.62697 WP_005650512.1.63539 WP_005650512.1.74240 WP_005650512.1.74810 WP_005650512.1.76348 WP_005650512.1.78014 WP_005650512.1.79255 WP_005650512.1.79564 WP_005650512.1.79785 WP_005650512.1.8829 WP_005650512.1.90320 WP_005650512.1.91188 WP_005650512.1.91769 WP_005650512.1.92858 WP_005650512.1.97721 WP_005650512.1.99326 WP_005650512.1.99776 gi|386264165|ref|YP_005827658.1| gi|148826909|ref|YP_001291662.1| gi|68250057|ref|YP_249169.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]