SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|148826910|ref|YP_001291663.1| from Haemophilus influenzae PittGG

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|148826910|ref|YP_001291663.1|
Domain Number 1 Region: 80-209
Classification Level Classification E-value
Superfamily LexA/Signal peptidase 1.92e-18
Family LexA-related 0.0083
Further Details:      
 
Weak hits

Sequence:  gi|148826910|ref|YP_001291663.1|
Domain Number - Region: 2-48
Classification Level Classification E-value
Superfamily lambda repressor-like DNA-binding domains 0.00157
Family Phage repressors 0.077
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|148826910|ref|YP_001291663.1|
Sequence length 213
Comment transcriptional regulator [Haemophilus influenzae PittGG]
Sequence
MDLQKAVGVTYEMARRYTLGTATPRDNKIEAIAKYFGVTPAHLKYGTVDPLENQVTSNVK
DVGSFDLWDRNTPLNSDEYAVPFYQDIRLAAGNGFADDIADYNNFKLRFSKSTLRKQGVQ
YENAVCVIADGNSMEPVIPDGTTVGIDLGNKTIRDGKIYAINHGGLLRIKLLYNMPNEQV
KIRSYNSEEHPDEIADMQDISVIGKVFWYSVLL
Download sequence
Identical sequences A5UES4
374931.CGSHiGG_00920 gi|148826910|ref|YP_001291663.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]