SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|148826978|ref|YP_001291731.1| from Haemophilus influenzae PittGG

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|148826978|ref|YP_001291731.1|
Domain Number 1 Region: 26-88
Classification Level Classification E-value
Superfamily L35p-like 7.59e-22
Family Ribosomal protein L35p 0.0000721
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|148826978|ref|YP_001291731.1|
Sequence length 89
Comment 50S ribosomal protein L35 [Haemophilus influenzae PittGG]
Sequence
MLPSNFISSPDYVVLNEKCGVILTMPKIKTVRGAAKRFKKTASGGFKRKQSHLRHILTKK
TTKRKRHLRHKSMVAKADQVLVVACLPYA
Download sequence
Identical sequences A0A0E1SV05 A0A121Y434 A4MZW0 A5UEZ2 E7A4J6 F2C256
gi|148826978|ref|YP_001291731.1| gi|319897109|ref|YP_004135304.1| 374931.CGSHiGG_01300 gi|319776261|ref|YP_004138749.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]