SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|148826993|ref|YP_001291746.1| from Haemophilus influenzae PittGG

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|148826993|ref|YP_001291746.1|
Domain Number 1 Region: 195-393
Classification Level Classification E-value
Superfamily PheT/TilS domain 1.28e-75
Family B3/B4 domain of PheRS, PheT 0.00000914
Further Details:      
 
Domain Number 2 Region: 467-690
Classification Level Classification E-value
Superfamily Class II aaRS and biotin synthetases 6.46e-51
Family Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain 0.0001
Further Details:      
 
Domain Number 3 Region: 36-196
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 8.85e-47
Family Myf domain 0.0028
Further Details:      
 
Domain Number 4 Region: 696-794
Classification Level Classification E-value
Superfamily Anticodon-binding domain of PheRS 4.18e-31
Family Anticodon-binding domain of PheRS 0.00046
Further Details:      
 
Domain Number 5 Region: 404-475
Classification Level Classification E-value
Superfamily Putative DNA-binding domain 7.14e-20
Family Domains B1 and B5 of PheRS-beta, PheT 0.0024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|148826993|ref|YP_001291746.1|
Sequence length 795
Comment phenylalanyl-tRNA synthetase subunit beta [Haemophilus influenzae PittGG]
Sequence
MKFSEQWVREWVNPAVSTEQLCEQITMLGLEVDGVESVAGTFNGVVVGEVVECAQHPDAD
KLRVTKVNVGGDRLLDIVCGAANCRQGLKVACATEGAVLPGDFKIKKTKLRGQPSEGMLC
SFSELGIDVEADGIIELPLDAPIGTDLREYLALDDNAIEISLTPNRADCLSIAGIAREIG
VVNKQLVNQPHFEAVPATISDKVQIDLQAPEACPRYLLRVIKNVNVKAPSPMWMQEKLRR
CGIRSIDPIVDITNYILLEFGQPMHAFDAAKVTQPVQVRFAKEGEELVLLDGSIAKLQSN
TLLIADQNGALAMAGIFGGAESGVNSETKDVILESAFFAPLAIAGRARQYGLHTDASHRF
ERGVDFELARKAMERATALLLEICGGEAGEICEASSETHLPKVNTVQLRRSKLDALLGHH
IETESVTEIFHRLGFDVTYANDIWTVTSASWRFDIEIEEDLIEEVARIYGYNSIPNNAPL
AHLRMREHKESDLDLARIKTALVDADYQEAITYSFVDPKIQSLLHPHKEALVLPNPISVE
MSAMRVSLISGLLGAVLYNQNRQQSRVRLFETGLRFVPDANAEFGVRQEFVLSAVITGTA
KSEHWAGKAESVDFFDLKGDLESVLSLTEGGNRVRFVAKQFDALHPGQSAAIELDGQEIG
FIGAIHPSISQKLGLNGKTFVFEILWNAIAARNVVQAKEISKFPANRRDLALVVADSVPA
GELIAACKQAGGEKLVQVNLFDVYQGVGVAEGYKSLAISLTVQDNEKTLEDEEINAVISA
VLAEVKQRFNAELRD
Download sequence
Identical sequences A5UF07
374931.CGSHiGG_01395 gi|148826993|ref|YP_001291746.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]