SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|148827016|ref|YP_001291769.1| from Haemophilus influenzae PittGG

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|148827016|ref|YP_001291769.1|
Domain Number 1 Region: 2-197
Classification Level Classification E-value
Superfamily DNA methylase specificity domain 1.06e-35
Family Type I restriction modification DNA specificity domain 0.0022
Further Details:      
 
Domain Number 2 Region: 248-459
Classification Level Classification E-value
Superfamily DNA methylase specificity domain 4.25e-32
Family Type I restriction modification DNA specificity domain 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|148827016|ref|YP_001291769.1|
Sequence length 459
Comment putative type I restriction enzyme HindVIIP specificity protein [Haemophilus influenzae PittGG]
Sequence
MSKLGNYISVQNGYAFKSKDFIKNLSGMPVIKIGNVTGGSFIDLSSYDTISEEIARKVKS
FQTKDDDILIAMTGANVGKVSRIAKGTQPCLINQRVGRLILKEDCPYSSDFIYYLVSSNK
SFQYFSNTADGAAQPNISGKLIEDLEFPDISPKSANKAGKHLKVLDEKIQLNTQINQTLE
QIAQALFKSWFVDFDPVRAKVQALSEGMSLEQAELAAMQTISGKTPEELTALSQTQPDRY
AELAETAKAFPCEMVEVDGGEVPKGWEKTTLSEICEMQNGYAFKSFDWMEQGIPVIKIGS
VKPIIVEVEGNGFVSEDYSKLKPDFLLTSSDILVGLTGYVGEVGRIPTGKIAMLNQRVAK
FLPKEIDKNHCFYNYIYCLARQSQFKEFAEINAKGSAQANISTKELLKFPIIKANDKLHI
LFENRVKELLERILWNSQNAETLAKTRDLLLPRLLNGEV
Download sequence
Identical sequences A5UF30
374931.CGSHiGG_01530 gi|148827016|ref|YP_001291769.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]