SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|148827029|ref|YP_001291782.1| from Haemophilus influenzae PittGG

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|148827029|ref|YP_001291782.1|
Domain Number 1 Region: 4-242
Classification Level Classification E-value
Superfamily Metallo-hydrolase/oxidoreductase 1.16e-49
Family Glyoxalase II (hydroxyacylglutathione hydrolase) 0.0000232
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|148827029|ref|YP_001291782.1|
Sequence length 243
Comment hydroxyacylglutathione hydrolase [Haemophilus influenzae PittGG]
Sequence
MLFALPALNDNYIWLYQRENLPLIIVDLPETDKLFAWLDKQNATVEAVLLTHEHDDHTQG
VSAFKKRYPTVPIYGPQECEKKGATQIVNEGKILTANYQIDVIPTGGHTKQHVSFLVDNH
LFCGDALFSAGCGRVFTGNYALMFEGLQRLNTLPDETIVCPAHEYTLGNLAFAETVLVDK
SAVEKSAVEKSAVEKQRIFVETQRAENKPSLPTTLKLEREINPFLQAKTLEEFTALRKAK
DIF
Download sequence
Identical sequences A0A1Q5Y2Z8 A5UF43
374931.CGSHiGG_01615 gi|148827029|ref|YP_001291782.1| WP_011962171.1.45125

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]