SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|148827042|ref|YP_001291795.1| from Haemophilus influenzae PittGG

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|148827042|ref|YP_001291795.1|
Domain Number 1 Region: 10-86
Classification Level Classification E-value
Superfamily lambda repressor-like DNA-binding domains 4.77e-23
Family SinR domain-like 0.0051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|148827042|ref|YP_001291795.1|
Sequence length 107
Comment plasmid maintenance system antidote protein [Haemophilus influenzae PittGG]
Sequence
MMTRKPTSVGEILQEEFLEPLSLKINDLAQILDVHRNTASNIVNNSSRITLEMAVKLAKA
FDTTPEFWLNLQTRIDLWELEHNKRFQQSLANVKPALHRHGTSTFAM
Download sequence
Identical sequences A0A1Q5Y305 A5UF56 H1LMA4
374931.CGSHiGG_01745 gi|148827042|ref|YP_001291795.1| WP_009499989.1.45125 WP_009499989.1.47625

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]