SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|148827144|ref|YP_001291897.1| from Haemophilus influenzae PittGG

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|148827144|ref|YP_001291897.1|
Domain Number 1 Region: 191-441
Classification Level Classification E-value
Superfamily Argininosuccinate synthetase, C-terminal domain 1.7e-79
Family Argininosuccinate synthetase, C-terminal domain 0.00000000692
Further Details:      
 
Domain Number 2 Region: 5-188
Classification Level Classification E-value
Superfamily Adenine nucleotide alpha hydrolases-like 1.97e-33
Family N-type ATP pyrophosphatases 0.000000047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|148827144|ref|YP_001291897.1|
Sequence length 444
Comment argininosuccinate synthase [Haemophilus influenzae PittGG]
Sequence
MSNTILQNLPKGQKVGIAFSGGLDTSAALLWMRQKGAVPYAYTANLGQPDEDDYNAIPKK
AMAYGAENARLIDCRAQLAHEGIAAIQCGAFHISTGGIPYFNTTPLGRAVTGTMLVAAMK
EDDVNIWGDGSTFKGNDIERFYRYGLLTNPNLKIYKPWLDVQFIEELGGRLEMSQFLIEN
GFDYKMSVEKAYSTDSNMLGATHEAKDLEQLSTGMKIVKPIMGVAFWDEKVEIKPETVTV
TFEDGVPVALNGKHFDNAVDLILEANRIGGRHGLGMSDQIENRIIEAKSRGIYEAPGMAL
LHIAYERLVTGIHNEDTIEQYRINGIRLGRLLYQGRWFDPQALMLRETAQRWVAKAITGT
VTLELRRGNDFTILNTESPNLTYEAERLSMEKVEDAPFDPIDRIGQLTMRNLDVSDTRGK
LGIYAQTGLLSAIKDSVLPQLGKK
Download sequence
Identical sequences A0A1Q5Y3H1 A5UFF8 P44315
gi|148827144|ref|YP_001291897.1| gi|16273613|ref|NP_439868.1| NP_439868.1.63031 WP_005694213.1.39279 WP_005694213.1.45125 WP_005694213.1.61635 WP_005694213.1.9694 374931.CGSHiGG_02370 71421.HI1727

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]