SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|148827152|ref|YP_001291905.1| from Haemophilus influenzae PittGG

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|148827152|ref|YP_001291905.1|
Domain Number - Region: 27-96
Classification Level Classification E-value
Superfamily Clc chloride channel 0.0968
Family Clc chloride channel 0.031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|148827152|ref|YP_001291905.1|
Sequence length 109
Comment putative branched-chain amino acid permease [Haemophilus influenzae PittGG]
Sequence
MTLTEQIITIGICIVAVQFTRLLPFFVFPVNRPIPQYIRYLGKVLPPAMFGMLVVYCYKN
IEILTGYHGIPDLLAGIVVLGLHFWKKNMFLSIAVGTLFYMALVQLIFI
Download sequence
Identical sequences A0A0E1SMP4 A0A0E1WH34 A0A0Y0CWQ0 A0A1Q5Y3I1 A4MZ76 A4N6R7 A5UFG6 E1X8M1 Q4QJL1
gi|148827152|ref|YP_001291905.1| WP_005649924.1.10621 WP_005649924.1.12329 WP_005649924.1.13610 WP_005649924.1.15261 WP_005649924.1.17459 WP_005649924.1.20018 WP_005649924.1.20853 WP_005649924.1.23065 WP_005649924.1.23149 WP_005649924.1.23920 WP_005649924.1.25656 WP_005649924.1.26667 WP_005649924.1.27712 WP_005649924.1.28397 WP_005649924.1.32414 WP_005649924.1.32618 WP_005649924.1.32982 WP_005649924.1.34722 WP_005649924.1.34925 WP_005649924.1.37003 WP_005649924.1.37452 WP_005649924.1.38938 WP_005649924.1.39279 WP_005649924.1.40040 WP_005649924.1.40343 WP_005649924.1.40503 WP_005649924.1.40942 WP_005649924.1.42240 WP_005649924.1.42267 WP_005649924.1.43923 WP_005649924.1.44893 WP_005649924.1.45125 WP_005649924.1.4569 WP_005649924.1.50588 WP_005649924.1.50795 WP_005649924.1.5387 WP_005649924.1.53947 WP_005649924.1.56005 WP_005649924.1.57312 WP_005649924.1.59352 WP_005649924.1.59529 WP_005649924.1.6054 WP_005649924.1.61426 WP_005649924.1.62697 WP_005649924.1.63539 WP_005649924.1.64134 WP_005649924.1.74240 WP_005649924.1.74810 WP_005649924.1.75193 WP_005649924.1.75514 WP_005649924.1.75525 WP_005649924.1.76410 WP_005649924.1.76737 WP_005649924.1.78014 WP_005649924.1.80605 WP_005649924.1.82376 WP_005649924.1.82381 WP_005649924.1.85244 WP_005649924.1.85362 WP_005649924.1.86544 WP_005649924.1.86649 WP_005649924.1.8829 WP_005649924.1.88810 WP_005649924.1.90320 WP_005649924.1.91188 WP_005649924.1.91647 WP_005649924.1.91769 WP_005649924.1.92858 WP_005649924.1.93392 WP_005649924.1.93723 WP_005649924.1.94547 WP_005649924.1.94621 WP_005649924.1.9601 WP_005649924.1.9761 WP_005649924.1.99326 WP_005649924.1.99776 gi|378697974|ref|YP_005179932.1| 281310.NTHI2046 374930.CGSHiEE_03360 374931.CGSHiGG_02420 gi|148825727|ref|YP_001290480.1| gi|68250334|ref|YP_249446.1| gi|386263913|ref|YP_005827406.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]