SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|148827247|ref|YP_001292000.1| from Haemophilus influenzae PittGG

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|148827247|ref|YP_001292000.1|
Domain Number 1 Region: 210-422
Classification Level Classification E-value
Superfamily DNA methylase specificity domain 7.03e-46
Family Type I restriction modification DNA specificity domain 0.0000528
Further Details:      
 
Domain Number 2 Region: 4-211
Classification Level Classification E-value
Superfamily DNA methylase specificity domain 2.45e-32
Family Type I restriction modification DNA specificity domain 0.0033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|148827247|ref|YP_001292000.1|
Sequence length 424
Comment type I restriction modification DNA specificity domain-containing protein [Haemophilus influenzae PittGG]
Sequence
MRRYESYKDSGVEWLGEVPSHWNLIPNKYIFKLRKNVVGKRSSEYDLLSLSLKGVIKRDM
ENPEGKFPAEFDTYQEVKEGDFIFCLFDVEETPRTVGLSSYHGMITGAYTIFETNNVDKK
FIYYFYLNLDSDKRLKPLYKGLRNTISKETFFSFNTFIPPLSEQQKIAQFLDDKTAKIDQ
AVDLAEKQIALLKEHKQILIQNSVTRGLNPDVPLKDSGVEWIGQVPEHWEILSIKRLSQV
KRGASPRPIDNPKYFDNDGEYAWVRISDVTASNMYLLETTQKLSNLGKSYSVPLMPGSLF
LSIAGSVGKPIITKIKVCIHDGFVYFPENKQNTKFLYYIFYSEQPYIGLGKMGTQLNLNT
DTVGAIKIPIPPLCEQQKIADYLDTQTAKIDQAIALKTAHIEKLKEYKSVLINDVVTGKV
RVSV
Download sequence
Identical sequences A0A1Q5Y488 A5UFR1
gi|148827247|ref|YP_001292000.1| WP_012054811.1.45125 374931.CGSHiGG_03085

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]