SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|148827296|ref|YP_001292049.1| from Haemophilus influenzae PittGG

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|148827296|ref|YP_001292049.1|
Domain Number 1 Region: 4-123,191-311
Classification Level Classification E-value
Superfamily FabD/lysophospholipase-like 3.4e-80
Family FabD-like 0.0000000539
Further Details:      
 
Domain Number 2 Region: 129-198
Classification Level Classification E-value
Superfamily Probable ACP-binding domain of malonyl-CoA ACP transacylase 1.19e-17
Family Probable ACP-binding domain of malonyl-CoA ACP transacylase 0.0000718
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|148827296|ref|YP_001292049.1|
Sequence length 312
Comment acyl carrier protein S-malonyltransferase [Haemophilus influenzae PittGG]
Sequence
MKKFAMVFPGQGSQTVGMLADLATEYPIVIETFKQASDALGYDLWYLVQQGPAEELNKTW
QTQPALLAASVAIYRVWKEKFPQLKPEVMAGHSLGEYSALVCAGVLDFQDAIKLVELRGK
LMQQAVPEGTGAMYAIIGLDNEAIINACKQAEEGEVVSAVNFNSPGQVVIAGAKAAVERA
AALCKEAGAKRALPLAVSVPSHCALMKPAAEQLAVTLENIQINTPTTSVLNNVDVKAETE
GTEIRTALVRQLYSPVRWTETVEKMAQDGVLALVEVGPGKVLNGLTKRIVGDLQAISVND
VASFNAVEEFLA
Download sequence
Identical sequences A0A1Q5Y3R2 A5UFW0
gi|148827296|ref|YP_001292049.1| WP_012054846.1.45125 374931.CGSHiGG_03375

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]