SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|148827313|ref|YP_001292066.1| from Haemophilus influenzae PittGG

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|148827313|ref|YP_001292066.1|
Domain Number 1 Region: 4-243
Classification Level Classification E-value
Superfamily CNF1/YfiH-like putative cysteine hydrolases 3.3e-84
Family YfiH-like 0.000000192
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|148827313|ref|YP_001292066.1|
Sequence length 244
Comment hypothetical protein CGSHiGG_03470 [Haemophilus influenzae PittGG]
Sequence
MQAINPNWNVPKNIHAFTTTREGGVSSMPYFSFNLGDHVGDNKSAVKTNRTLLVEKFGLP
QTPIFLTQTHSTRVLQLPYSGQNLEADAVYTNVPNQVCVVMTADCLPVLFTTTSGNEVAA
THAGWRGLCDGVLEETVKYFQAKPEDIIAWFGPAIGPKAFQVGIDVVEKFVAVDEKAKLA
FQPDAIEEGKYLSNLYQIATQRLNNLGITQIYGGNHCTFNEKEKFFSYRRDNQTGRMASV
IWFE
Download sequence
Identical sequences A5UFX7
gi|148827313|ref|YP_001292066.1| 374931.CGSHiGG_03470

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]