SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|148827325|ref|YP_001292078.1| from Haemophilus influenzae PittGG

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|148827325|ref|YP_001292078.1|
Domain Number 1 Region: 3-117
Classification Level Classification E-value
Superfamily Putative DNA-binding domain 8.79e-29
Family DNA-binding N-terminal domain of transcription activators 0.0074
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|148827325|ref|YP_001292078.1|
Sequence length 135
Comment putative HTH-type transcriptional regulator [Haemophilus influenzae PittGG]
Sequence
MTYTTAKAAEKIGISAYTLRFYDKEGLLPNVGRDEYGNRRFTDKDLQWLSLLQCLKNTGM
SLKDIKRFAECTIIGDDTIEERLSLFENQTKNVKCQIAELKRYLDLLEYKLAFYQKAKAL
GSVKAVNLPQIPETS
Download sequence
Identical sequences A0A0E1WI73 A0A1Q5Y3P8 A5UFY9 P44558 Q4QP05
APC322 gi|68248790|ref|YP_247902.1| 281310.NTHI0278 374931.CGSHiGG_03530 71421.HI0186 gi|319775945|ref|YP_004138433.1| NP_438354.1.63031 WP_005691542.1.12329 WP_005691542.1.12713 WP_005691542.1.15261 WP_005691542.1.17253 WP_005691542.1.20853 WP_005691542.1.23065 WP_005691542.1.23149 WP_005691542.1.23920 WP_005691542.1.25656 WP_005691542.1.28397 WP_005691542.1.32414 WP_005691542.1.34722 WP_005691542.1.3733 WP_005691542.1.39974 WP_005691542.1.40343 WP_005691542.1.42821 WP_005691542.1.43923 WP_005691542.1.44893 WP_005691542.1.45125 WP_005691542.1.4569 WP_005691542.1.5387 WP_005691542.1.54653 WP_005691542.1.55069 WP_005691542.1.59352 WP_005691542.1.59529 WP_005691542.1.61426 WP_005691542.1.61635 WP_005691542.1.62697 WP_005691542.1.63539 WP_005691542.1.64134 WP_005691542.1.68713 WP_005691542.1.74240 WP_005691542.1.74810 WP_005691542.1.75525 WP_005691542.1.76348 WP_005691542.1.76422 WP_005691542.1.79255 WP_005691542.1.79785 WP_005691542.1.85244 WP_005691542.1.86544 WP_005691542.1.90320 WP_005691542.1.91769 WP_005691542.1.92858 WP_005691542.1.94547 WP_005691542.1.94621 WP_005691542.1.9601 WP_005691542.1.9694 WP_005691542.1.97721 WP_005691542.1.98200 WP_005691542.1.99326 WP_005691542.1.99776 gi|148827325|ref|YP_001292078.1| gi|386265457|ref|YP_005828949.1| gi|16272151|ref|NP_438354.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]