SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|148827334|ref|YP_001292087.1| from Haemophilus influenzae PittGG

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|148827334|ref|YP_001292087.1|
Domain Number 1 Region: 992-1092
Classification Level Classification E-value
Superfamily Mechanosensitive channel protein MscS (YggB), C-terminal domain 7.45e-25
Family Mechanosensitive channel protein MscS (YggB), C-terminal domain 0.0022
Further Details:      
 
Domain Number 2 Region: 925-989
Classification Level Classification E-value
Superfamily Sm-like ribonucleoproteins 1.08e-16
Family Mechanosensitive channel protein MscS (YggB), middle domain 0.0012
Further Details:      
 
Domain Number 3 Region: 838-923
Classification Level Classification E-value
Superfamily Mechanosensitive channel protein MscS (YggB), transmembrane region 0.00000011
Family Mechanosensitive channel protein MscS (YggB), transmembrane region 0.0046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|148827334|ref|YP_001292087.1|
Sequence length 1106
Comment potassium efflux protein KefA [Haemophilus influenzae PittGG]
Sequence
MKIPPFFTALFASAMFTLSVSQGVLAANSTNVLPTEQSLKADLANAQKMSEGEAKNRLLA
ELQTSIDLLQQIQAQQKINDALQTTLSHSESEIRKNNAEIQALKKQQETATSTDDNAQSQ
DYLQNSLTKLNDQLQDTQNALSTANAQLAGQSSISERAQAALTENVVRTQQINQQLANND
IGSILRKQYQIELQLIDLKNSYNQNLLKNNDQLSLLYQSRYDLLNLRLQVQQQNIIAIQE
VINQKNLQQSQNQVEQAQQQQKTVQNDYIQKELDRNAQLSQYLLQQTEKANSLTQDELRM
RNILDSLTQTQRTIDEQISALQGTLVLSRIIQQQKQKLPTNLNIQGLSKQIADLRVHIFD
ITQKRNELYDLDNYINKVESEDGKQFTEAERTQVKTLLTERRKMTSDLIKSLNNQLNLAI
SLELTQLQITQISDQIQSKLEQQSFWVKSNNPIDLDWVKMLPRALIEQFNGMLKKLGFPT
NYDNLPYLLMYFLGLFIVGGAIFKFKNRIKQQLNKINREIHRLDTDSQWSTPLALLLTAF
LTLSSTLWFLAVCQMIGFFFFKNPEEFWHWSFSMAGYWWFFTFWISLFRPNGIFVNHFES
SKENAQRFRGVIQRIIIVVVLLLNTSVFSNVTDAGLANDVLGQINTIAALIFCAAIIAPR
FNRVLRSYEPETNKHHWLIRIVQIGLRLIPVGLIVLIVLGYYYTALNLIEHFIHSYIAWC
VWWLVRNTIYRGITVSSRRLAHRRLAEKRRQKALENNYENISSDDVVAVGEPEESLALND
VRSQLLRFVDLFIWTALLGIFYYVWSDLVTVVSYLREITLWQQTTTTDAGTVMESITLFN
LLVALVIVGITYVLVRNISGILEVLIFSRVNLSQGTPYTITTLLTYIFIAIGGAWAFTTL
GISWSKLQWLFAALSVGLGFGMQEIFANFVSGIILLFERPIRVGDVVTINEVSGTVAKIR
IRAITLIDFDRKEVIVPNKSFVTGQVTNWALSNTMTRLVISVGVAYGSDLTLVRQLLLQA
ADEQPTILRDPKPSAYFLTFGASTLDHELRVYVEQVGDRTSTTDALNRRINELFAEHNID
IAFNQLDVFIKNNDTGEEIPFVDVKK
Download sequence
Identical sequences A5UFZ8
gi|148827334|ref|YP_001292087.1| 374931.CGSHiGG_03585

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]