SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|148827355|ref|YP_001292108.1| from Haemophilus influenzae PittGG

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|148827355|ref|YP_001292108.1|
Domain Number 1 Region: 215-388
Classification Level Classification E-value
Superfamily DNA methylase specificity domain 6.05e-31
Family Type I restriction modification DNA specificity domain 0.0048
Further Details:      
 
Domain Number 2 Region: 56-209
Classification Level Classification E-value
Superfamily DNA methylase specificity domain 1.64e-26
Family Type I restriction modification DNA specificity domain 0.0078
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|148827355|ref|YP_001292108.1|
Sequence length 390
Comment putative type I restriction-modification system, specificity determinant; restriction endonuclease [Haemophilus influenzae PittGG]
Sequence
MKNNRTFLEKLLDGSEVEWKPLWSITTWDKRFNAVEKEKQPKVIKYHYYLASELKPLIVD
GGNVKLLTTNESDIWTTEELVQNNISEGEIIAIPWGGNPIVQYYKGKFVTADNRIATSNN
TKILDNKFLYYFLLSKLDVISSFYRGSGIKHPSMYHVLEMLIPIPPLSVQTEIVKILDAL
TALTSELTSELILRQKQYEYYREKLLSEEELGKIGVQWKALGEIVPISRGKRLIRSQLKD
NDQYPVYQNSLQPLGYYDHKNCRAYMTFVIAAGAAGEIGFSNVEFWSADDCYYFDCANKI
LHDKFLYYFLLSNKHLLTNQVRKASVPRLSRVSIEKIKIPIVSFKEQERIVAILDKFETL
THSMTEGLPLAIEQSQKRYEYYRELLLNFS
Download sequence
Identical sequences A0A1Q5Y3L6 A5UG19
WP_012054881.1.45125 gi|148827355|ref|YP_001292108.1| 374931.CGSHiGG_03700

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]