SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|148827408|ref|YP_001292161.1| from Haemophilus influenzae PittGG

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|148827408|ref|YP_001292161.1|
Domain Number - Region: 6-55
Classification Level Classification E-value
Superfamily Putative DNA-binding domain 0.00106
Family DNA-binding N-terminal domain of transcription activators 0.068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|148827408|ref|YP_001292161.1|
Sequence length 71
Comment hypothetical protein CGSHiGG_04020 [Haemophilus influenzae PittGG]
Sequence
MTLKTLLTIQELEEMGIAKRTKIYYMMKRGNFPKPLKYDRTNRWAREDVQAWLDKQNPNR
KQEAQHGGLTA
Download sequence
Identical sequences A0A1Q5Y232 A5UG72
gi|148827408|ref|YP_001292161.1| WP_012054916.1.45125 374931.CGSHiGG_04020

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]