SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|148827413|ref|YP_001292166.1| from Haemophilus influenzae PittGG

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|148827413|ref|YP_001292166.1|
Domain Number - Region: 11-62
Classification Level Classification E-value
Superfamily Putative DNA-binding domain 0.000714
Family Terminase gpNU1 subunit domain 0.079
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|148827413|ref|YP_001292166.1|
Sequence length 71
Comment transcriptional regulator [Haemophilus influenzae PittGG]
Sequence
MNEKMPQAERFIKLPEVMNKTGLGRSSIYRKMNTGDFPRSIQLNKNNIVWLESEVNAWMQ
AQIEKRNQKEK
Download sequence
Identical sequences A0A0M1GP29 A0A1Q5Y289 A5UG77
gi|148827413|ref|YP_001292166.1| 374931.CGSHiGG_04055 WP_012054921.1.45125 WP_012054921.1.72517

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]