SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|148827422|ref|YP_001292175.1| from Haemophilus influenzae PittGG

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|148827422|ref|YP_001292175.1|
Domain Number - Region: 6-166
Classification Level Classification E-value
Superfamily Clc chloride channel 0.0196
Family Clc chloride channel 0.0078
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|148827422|ref|YP_001292175.1|
Sequence length 199
Comment putative glycerol-3-phosphate acyltransferase PlsY [Haemophilus influenzae PittGG]
Sequence
MSLFALFYMLFAYLLGSISSAILICRIAGLPDPRQNGSHNPGATNVLRIGNRKSALAVLI
FDMLKGMIPVWAGYYLGLTQFELGMVALGACLGHIFPIFFQFKGGKGVATAFGAIAPISW
AVAGSMFGTWIFVFLVSGYSSLSAVISALLVPFYVWWFKPEFTFPVALVCCLLIYRHHDN
IQRLWRGQEDKVWAKFKKK
Download sequence
Identical sequences A0A0C5FAY7 A0A0Y0EM59 A4N4J7 A5UG86 E1X9K0 P44603 Q4QNS2
281310.NTHI0373 374931.CGSHiGG_04120 71421.HI0266 NP_438435.1.63031 WP_005653382.1.101347 WP_005653382.1.10621 WP_005653382.1.13610 WP_005653382.1.17428 WP_005653382.1.20073 WP_005653382.1.23065 WP_005653382.1.25413 WP_005653382.1.26667 WP_005653382.1.28397 WP_005653382.1.34925 WP_005653382.1.37452 WP_005653382.1.38938 WP_005653382.1.39974 WP_005653382.1.42267 WP_005653382.1.42821 WP_005653382.1.45125 WP_005653382.1.50588 WP_005653382.1.50795 WP_005653382.1.56181 WP_005653382.1.57312 WP_005653382.1.6054 WP_005653382.1.61426 WP_005653382.1.61635 WP_005653382.1.62109 WP_005653382.1.71424 WP_005653382.1.75193 WP_005653382.1.76737 WP_005653382.1.82376 WP_005653382.1.85362 WP_005653382.1.8638 WP_005653382.1.86649 WP_005653382.1.87894 WP_005653382.1.8829 WP_005653382.1.88810 WP_005653382.1.91188 WP_005653382.1.93392 WP_005653382.1.96546 WP_005653382.1.9694 WP_005653382.1.9761 gi|68248873|ref|YP_247985.1| gi|148827422|ref|YP_001292175.1| gi|16272224|ref|NP_438435.1| gi|378696398|ref|YP_005178356.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]