SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|148827552|ref|YP_001292305.1| from Haemophilus influenzae PittGG

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|148827552|ref|YP_001292305.1|
Domain Number 1 Region: 2-62
Classification Level Classification E-value
Superfamily lambda repressor-like DNA-binding domains 0.000000000000182
Family Phage repressors 0.0081
Further Details:      
 
Domain Number 2 Region: 154-247
Classification Level Classification E-value
Superfamily LexA/Signal peptidase 0.000000000192
Family LexA-related 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|148827552|ref|YP_001292305.1|
Sequence length 256
Comment hypothetical protein CGSHiGG_04885 [Haemophilus influenzae PittGG]
Sequence
MTTLAERLKRTLLERNLTQNDLAEMVGTTQGAISNIVKGETQKPRNILEIANALGVDPNW
LRNGGDMIVSHSTLENSQINNNQGQTVNNFFDSGSDELREMLHKQQISLKTKPTEEWVFA
LDVNRLAETDIINAHFPRPFEALHLSQDGMMDLLKLRSTANVAMITMFNESMSPVINKKD
LMFVDTNCKQYAGEGIYLFVMNNELYVRRLYQTPSGVLNAVAENERVGSSFEIDDLSRLN
VLGRCVRKFSIIAEDL
Download sequence
Identical sequences A0A1Q5Y3N2 A4N117 A5UGL6
gi|148827552|ref|YP_001292305.1| 374931.CGSHiGG_04885 WP_005651126.1.45125

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]