SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|148827553|ref|YP_001292306.1| from Haemophilus influenzae PittGG

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|148827553|ref|YP_001292306.1|
Domain Number 1 Region: 5-62
Classification Level Classification E-value
Superfamily lambda repressor-like DNA-binding domains 0.000000000000876
Family Phage repressors 0.035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|148827553|ref|YP_001292306.1|
Sequence length 68
Comment hypothetical protein CGSHiGG_04890 [Haemophilus influenzae PittGG]
Sequence
MQNETINLAIQECGTQKKLANACGVTQGAVALWLKGGGINGKYIPLIAKASNGKVTETDI
LRSLTKSQ
Download sequence
Identical sequences A0A0E1WG59 A0A1Q5Y3H5 A4N116 A5UGL7 F9H7Y6
374931.CGSHiGG_04890 gi|148827553|ref|YP_001292306.1| WP_005643392.1.10621 WP_005643392.1.32414 WP_005643392.1.45125 WP_005643392.1.50795 WP_005643392.1.59051

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]