SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|148827598|ref|YP_001292351.1| from Haemophilus influenzae PittGG

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|148827598|ref|YP_001292351.1|
Domain Number 1 Region: 11-287
Classification Level Classification E-value
Superfamily Clavaminate synthase-like 1.79e-62
Family Asparaginyl hydroxylase-like 0.056
Further Details:      
 
Weak hits

Sequence:  gi|148827598|ref|YP_001292351.1|
Domain Number - Region: 274-341
Classification Level Classification E-value
Superfamily Putative DNA-binding domain 0.00247
Family Dachshund-homology domain 0.005
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|148827598|ref|YP_001292351.1|
Sequence length 404
Comment hypothetical protein CGSHiGG_05155 [Haemophilus influenzae PittGG]
Sequence
MTALSSVNFCLPEHITPEIFLRDYWQKKPLVIRNGLPEIVGQFEPQDIIELAQNEDVTAR
LVKTFSDDDWKVFFSPLSEKDFQQLPEKWSVLVQNLEQWSPELGQLWNKFGFIPQWQRDD
IMVSYAPKGGSVGKHYDEYDVFLVQGYGHRRWQVGKWCDASTEFKPNQSIRIFDDMGELV
IDEVMNPGDILYIPARMAHYGVAEDDCLTFSFGLRYPNLSNLIDSVSKGFCHQDPDLNLS
EFDLPLRLSQSEQRTGKLADENIQAMKQLLLDKLAHSEAFDTLFKQAAASAVSSRRYELL
VSDEMCDPDEVRSILEEDGAFLSQDNNCKLLYTENPLRIYANGEWLDELNIIESEVLKRL
SDGESLDWVFLSNLVNETEDPETSMDLLLDSICNWVDDGWALIE
Download sequence
Identical sequences A5UGR2
374931.CGSHiGG_05155 gi|148827598|ref|YP_001292351.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]