SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|148827626|ref|YP_001292379.1| from Haemophilus influenzae PittGG

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|148827626|ref|YP_001292379.1|
Domain Number 1 Region: 15-161
Classification Level Classification E-value
Superfamily DsbB-like 2.75e-44
Family DsbB-like 0.0000143
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|148827626|ref|YP_001292379.1|
Sequence length 177
Comment disulfide bond formation protein B [Haemophilus influenzae PittGG]
Sequence
MLALLKQFSEKRFVWFLLAFSSLSLESTALYFQYGMGLQPCVLCVYERLAMIGLFVAGII
ALLQPRALIIRLIALALGLFSSIKGLLISFRHLDLQMNPAPWKQCEFIPNFPETLPFHQW
FPFIFNPTGSCNESQWSLFGLTMVQWLVVIFSLYVVILTLLLIAQVIKTRKQRRLFN
Download sequence
Identical sequences A0A1Q5Y2G6 A5UGU0
374931.CGSHiGG_05355 WP_012055027.1.45125 gi|148827626|ref|YP_001292379.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]