SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|148827661|ref|YP_001292414.1| from Haemophilus influenzae PittGG

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|148827661|ref|YP_001292414.1|
Domain Number 1 Region: 1-147
Classification Level Classification E-value
Superfamily NagB/RpiA/CoA transferase-like 7.44e-47
Family D-ribose-5-phosphate isomerase (RpiA), catalytic domain 0.000000625
Further Details:      
 
Domain Number 2 Region: 129-199
Classification Level Classification E-value
Superfamily D-ribose-5-phosphate isomerase (RpiA), lid domain 2.62e-22
Family D-ribose-5-phosphate isomerase (RpiA), lid domain 0.0000177
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|148827661|ref|YP_001292414.1|
Sequence length 219
Comment ribose-5-phosphate isomerase A [Haemophilus influenzae PittGG]
Sequence
MNQLEMKKLAAQAALQYVKADTIVGVGSGSTVNCFIEALGTIKDKIQGAVAASKESEELL
RKQGIEVFNANDVSSLDIYVDGADEINPQKMMIKGGGAALTREKIVAALAKKFICIVDSS
KQVDVLGSTFPLPVEVIPMARSQVGRKLVALGGSPEYREDVVTDNGNVILDVHNFSILNP
VEMEKELNNVSGVVTNGIFALRGADVVIVGTPEGAKIID
Download sequence
Identical sequences A0A1Q5Y6V9 A5UGX5
gi|148827661|ref|YP_001292414.1| WP_012055051.1.45125 374931.CGSHiGG_05560

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]