SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|148827703|ref|YP_001292456.1| from Haemophilus influenzae PittGG

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|148827703|ref|YP_001292456.1|
Domain Number 1 Region: 1-229
Classification Level Classification E-value
Superfamily YaeB-like 3.66e-84
Family YaeB-like 0.000000000668
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|148827703|ref|YP_001292456.1|
Sequence length 239
Comment 1,4-dihydroxy-2-naphthoate octaprenyltransferase [Haemophilus influenzae PittGG]
Sequence
MNDLTLSPIAIIHTPYKEKFSVPRQPNLVEDGVGIVELLPPYNSPEAVRGLEQFSHLWLI
FQFDQIQQGKWQPTVRPPRLGGNQRVGVFASRATHRPNPLGLSKVELRQVECINGNIFLH
LGAVDLVDGTPIFDIKPYIAYADSEPNAQSSFAQEKPPAKLTVEFTEQVKSAVKKREEKR
PHLSRFIRQVLEQDPRPAYQQGKPSDRIYGMSLYEFNVKWRIKAGTVNCVEVIEIEKDK
Download sequence
Identical sequences A0A0E1SQ71 A0A0E1WTZ9 A0A1Q5Y665 A4MYF5 A5UH17
374931.CGSHiGG_05810 gi|148827703|ref|YP_001292456.1| WP_005649451.1.20018 WP_005649451.1.32414 WP_005649451.1.40040 WP_005649451.1.40503 WP_005649451.1.45125 WP_005649451.1.62109 WP_005649451.1.71424 WP_005649451.1.78014 WP_005649451.1.96546 gi|386263299|ref|YP_005826792.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]