SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|148827802|ref|YP_001292555.1| from Haemophilus influenzae PittGG

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|148827802|ref|YP_001292555.1|
Domain Number 1 Region: 1-113
Classification Level Classification E-value
Superfamily Putative DNA-binding domain 5.13e-29
Family DNA-binding N-terminal domain of transcription activators 0.0016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|148827802|ref|YP_001292555.1|
Sequence length 130
Comment HTH-type transcriptional regulator [Haemophilus influenzae PittGG]
Sequence
MKINELSKSTHTNIETIRYYEKQGVLPPPKRLANGYRFYDEESIEQLNFIKKCRMLGFSL
ENIRELNRIRFSTKDHYQADQLVLNQLIQVENKISQLLEIKAFLQSIVTENEHNEEECKA
IEGLKSECNL
Download sequence
Identical sequences A0A0E1WI34 A0A0H3PG60 A0A0K9KK51 A0A0Y0GUM6 A0A1B8P805 A5UHB6 E1XAN3
WP_005644187.1.101347 WP_005644187.1.101989 WP_005644187.1.1191 WP_005644187.1.13610 WP_005644187.1.15927 WP_005644187.1.17428 WP_005644187.1.17459 WP_005644187.1.20073 WP_005644187.1.20853 WP_005644187.1.23065 WP_005644187.1.23920 WP_005644187.1.25656 WP_005644187.1.28339 WP_005644187.1.28397 WP_005644187.1.32414 WP_005644187.1.34722 WP_005644187.1.34925 WP_005644187.1.37452 WP_005644187.1.40343 WP_005644187.1.42267 WP_005644187.1.44893 WP_005644187.1.46862 WP_005644187.1.57312 WP_005644187.1.61426 WP_005644187.1.6349 WP_005644187.1.63539 WP_005644187.1.74023 WP_005644187.1.74240 WP_005644187.1.74810 WP_005644187.1.75193 WP_005644187.1.76410 WP_005644187.1.76737 WP_005644187.1.82376 WP_005644187.1.82381 WP_005644187.1.85362 WP_005644187.1.8638 WP_005644187.1.86649 WP_005644187.1.87894 WP_005644187.1.88810 WP_005644187.1.90238 WP_005644187.1.90586 WP_005644187.1.91769 WP_005644187.1.93392 WP_005644187.1.93723 WP_005644187.1.9761 gi|378696781|ref|YP_005178739.1| gi|148827802|ref|YP_001292555.1| 374931.CGSHiGG_06375

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]