SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|148827809|ref|YP_001292562.1| from Haemophilus influenzae PittGG

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|148827809|ref|YP_001292562.1|
Domain Number - Region: 1-37
Classification Level Classification E-value
Superfamily Clc chloride channel 0.000876
Family Clc chloride channel 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|148827809|ref|YP_001292562.1|
Sequence length 58
Comment elongation factor G [Haemophilus influenzae PittGG]
Sequence
MTGAQPVLIWLLISSIIASIISHQFSPKPFYHFAAGCFRQQMQARQAEELRSKTEQEK
Download sequence
Identical sequences A0A0E1WQZ0 A5UHC3
gi|148827809|ref|YP_001292562.1| 374931.CGSHiGG_06420

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]