SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|148827838|ref|YP_001292591.1| from Haemophilus influenzae PittGG

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|148827838|ref|YP_001292591.1|
Domain Number 1 Region: 23-92
Classification Level Classification E-value
Superfamily lambda repressor-like DNA-binding domains 0.00000000000000873
Family Probable transcriptional regulator VC1968, N-terminal domain 0.074
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|148827838|ref|YP_001292591.1|
Sequence length 98
Comment putative HTH-type transcriptional regulator [Haemophilus influenzae PittGG]
Sequence
MNKISPLGSNWNEFEQQIFNEEEIRESNLRVALIKELITSRQQLGISQKQLETLSGVKQP
MIARIEKGQTNPQLETLLKLLAPLGKTLSIVPLRVKNA
Download sequence
Identical sequences A0A0D0HPY4 A0A0E1SNY5 A0A0E1WIH6 A0A0H3PFH8 A4N0L6 A4N6B7 A5UHF2 A7LQ58 E1XAW0 F2BZK1 P44030 Q4QMQ7
gi|68249238|ref|YP_248350.1| gi|543951354|ref|YP_008543428.1| gi|386266610|ref|YP_005830102.1| gi|378696857|ref|YP_005178815.1| NP_438819.1.63031 WP_005650837.1.101989 WP_005650837.1.12329 WP_005650837.1.12387 WP_005650837.1.12713 WP_005650837.1.15261 WP_005650837.1.15927 WP_005650837.1.17173 WP_005650837.1.17253 WP_005650837.1.17459 WP_005650837.1.20018 WP_005650837.1.20644 WP_005650837.1.20853 WP_005650837.1.23065 WP_005650837.1.23149 WP_005650837.1.25413 WP_005650837.1.25656 WP_005650837.1.26077 WP_005650837.1.26667 WP_005650837.1.27712 WP_005650837.1.28397 WP_005650837.1.28719 WP_005650837.1.32414 WP_005650837.1.32618 WP_005650837.1.32982 WP_005650837.1.37003 WP_005650837.1.3733 WP_005650837.1.38951 WP_005650837.1.39279 WP_005650837.1.40038 WP_005650837.1.40040 WP_005650837.1.40503 WP_005650837.1.40942 WP_005650837.1.42240 WP_005650837.1.42267 WP_005650837.1.42729 WP_005650837.1.42821 WP_005650837.1.43923 WP_005650837.1.44893 WP_005650837.1.45125 WP_005650837.1.4569 WP_005650837.1.46862 WP_005650837.1.48995 WP_005650837.1.51509 WP_005650837.1.52701 WP_005650837.1.53947 WP_005650837.1.54653 WP_005650837.1.54661 WP_005650837.1.56005 WP_005650837.1.56181 WP_005650837.1.57312 WP_005650837.1.58856 WP_005650837.1.6054 WP_005650837.1.61426 WP_005650837.1.61635 WP_005650837.1.62109 WP_005650837.1.6349 WP_005650837.1.63539 WP_005650837.1.67509 WP_005650837.1.68713 WP_005650837.1.71424 WP_005650837.1.74023 WP_005650837.1.75193 WP_005650837.1.75514 WP_005650837.1.76348 WP_005650837.1.76369 WP_005650837.1.76410 WP_005650837.1.76422 WP_005650837.1.76737 WP_005650837.1.78014 WP_005650837.1.79255 WP_005650837.1.79564 WP_005650837.1.79785 WP_005650837.1.80605 WP_005650837.1.81823 WP_005650837.1.82376 WP_005650837.1.82381 WP_005650837.1.85244 WP_005650837.1.85362 WP_005650837.1.8638 WP_005650837.1.86649 WP_005650837.1.90238 WP_005650837.1.90320 WP_005650837.1.90586 WP_005650837.1.91647 WP_005650837.1.92138 WP_005650837.1.92858 WP_005650837.1.93392 WP_005650837.1.93908 WP_005650837.1.94547 WP_005650837.1.94621 WP_005650837.1.94624 WP_005650837.1.9601 WP_005650837.1.96396 WP_005650837.1.96546 WP_005650837.1.9694 WP_005650837.1.9761 WP_005650837.1.97721 WP_005650837.1.97818 WP_005650837.1.98200 WP_005650837.1.99326 WP_005650837.1.99776 APC89056 281310.NTHI0780 374930.CGSHiEE_08900 374931.CGSHiGG_06580 71421.HI0659 gi|148826705|ref|YP_001291458.1| gi|386264963|ref|YP_005828456.1| gi|16272602|ref|NP_438819.1| gi|148827838|ref|YP_001292591.1| gi|319775398|ref|YP_004137886.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]