SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|148827855|ref|YP_001292608.1| from Haemophilus influenzae PittGG

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|148827855|ref|YP_001292608.1|
Domain Number 1 Region: 88-291
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 3.94e-31
Family Phosphate binding protein-like 0.0016
Further Details:      
 
Domain Number 2 Region: 1-87
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 1.23e-20
Family LysR-like transcriptional regulators 0.0047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|148827855|ref|YP_001292608.1|
Sequence length 292
Comment DNA-binding transcriptional regulator IlvY [Haemophilus influenzae PittGG]
Sequence
MEFTDLQIFIHLSDTKNFTKTATQNHMSPSTLSRQIQRLEDELGKTLFIRDNRQVKLTEY
GEKFLQFAKTEWQNWQQFKQQLKDESDELCGEIKLFCSVTASYSHLPNVLKEFRQRYPKV
EIQLTTGDPALALELIQAQQVDLALAGKPNNLPSSVVFHKIDDISLSLIAPRVACLATQL
LQEKPIDWQQMPFIFPVEGHARQRIEQWLREKQIKHPKIYATVAGHEGIVPMVGLGFGLA
MLPDAVIDSSPMNNQISRLNLDKPIEPFELGICTQKRNLEQPLVRAFWAMLE
Download sequence
Identical sequences A0A1Q5Y2M1 A5UHG9
gi|148827855|ref|YP_001292608.1| WP_012055162.1.45125 374931.CGSHiGG_06695

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]