SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|148827859|ref|YP_001292612.1| from Haemophilus influenzae PittGG

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|148827859|ref|YP_001292612.1|
Domain Number 1 Region: 19-236,340-383
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 2.68e-41
Family FAD-linked reductases, N-terminal domain 0.0097
Further Details:      
 
Domain Number 2 Region: 236-327
Classification Level Classification E-value
Superfamily FAD-linked reductases, C-terminal domain 0.00000000000458
Family D-aminoacid oxidase-like 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|148827859|ref|YP_001292612.1|
Sequence length 563
Comment sn-glycerol-3-phosphate dehydrogenase subunit A [Haemophilus influenzae PittGG]
Sequence
MGLSPSIYKDVGDLSSLSTDVIIIGGGATGAGIARDCALRGIDCILLERRDIATGATGRN
HGLLHSGARYAVNDQESAEECIKENRILRKIARHCVDETEGLFITLPEDSLDYQKTFLES
CAKSGIDAQAIDPELAKIMEPSVNPDLVGAVVVPDGSIDPFRLTASNMMDATENGAKMFT
YCEVKNLIREGGKVIGVNVYDHKNRRERQFFAPLVVNASGIWGQGIAEYADLKIKMFPAK
GALLVMGHRINKLVINRCRKPADADILVPGDTICVIGTTSSRIPYDQIDNMEVTPEEVDI
LFREGEKLAPSLRHTRVLRAYAGVRPLVASDDDPSGRNVSRGIVLLDHAERDGLDGFITI
TGGKLMTYRLMAEWATDLVCKKLNKTARCVTAEQPLPGSTESRQETNQKVISLPSTIRYS
AVYRHGSRATRLLEKERLDRSMVCECEAVTAGEVRYAVDELDVNNLVDLRRRSRVGMGTC
QAELCACRAAGLMNRFEVATPRQSTTQLSAFMEERWRGIEPIAWGEAIREAEFTSWMYGS
VLGLNDVKPLDEQAQQGTDSNEF
Download sequence
Identical sequences A0A1Q5Y2M0 A5UHH3
WP_012055166.1.40503 WP_012055166.1.45125 WP_012055166.1.5387 WP_012055166.1.59352 WP_012055166.1.99326 gi|148827859|ref|YP_001292612.1| 374931.CGSHiGG_06725

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]