SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|148827934|ref|YP_001292687.1| from Haemophilus influenzae PittGG

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|148827934|ref|YP_001292687.1|
Domain Number 1 Region: 7-149
Classification Level Classification E-value
Superfamily SecB-like 1.05e-52
Family Bacterial protein-export protein SecB 0.00000012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|148827934|ref|YP_001292687.1|
Sequence length 168
Comment preprotein translocase subunit SecB [Haemophilus influenzae PittGG]
Sequence
MSEQKQDVAATEQQPVLQIQRIYVKDVSFEAPNLPHIFQQEWKPKLGFDLSTETTQVGDD
LYEVVLNISVETTLEDSGDVAFICEVKQAGVFTISGLEDVQMAHCLTSQCPNMLFPYARE
LVSNLVNRGTFPALNLSPVNFDALFVEYMNRQQAENAEEKSEEEQTKH
Download sequence
Identical sequences A0A1Q5Y4R8 A5UHP8
WP_012055212.1.42821 WP_012055212.1.45125 gi|148827934|ref|YP_001292687.1| 374931.CGSHiGG_07205

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]