SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|148827982|ref|YP_001292735.1| from Haemophilus influenzae PittGG

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|148827982|ref|YP_001292735.1|
Domain Number 1 Region: 83-177
Classification Level Classification E-value
Superfamily Ribosomal protein L6 3.02e-36
Family Ribosomal protein L6 0.00000455
Further Details:      
 
Domain Number 2 Region: 1-82
Classification Level Classification E-value
Superfamily Ribosomal protein L6 4.58e-23
Family Ribosomal protein L6 0.0000532
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|148827982|ref|YP_001292735.1|
Sequence length 177
Comment 50S ribosomal protein L6 [Haemophilus influenzae PittGG]
Sequence
MSRVAKAPVNIPAGVEVKLDGQLLTVKGKNGELSRKIHESVEVKQDNGQFTFTPREGFVE
ANAQSGTARALVNAMVIGVTEGFTKKLVLVGVGYRAQLKGNAIALSLGYSHPVEHTLPVG
ITAECPSQTEIVLKGADKQLIGQVAADIRAYRRPEPYKGKGVRYADEVVRIKEAKKK
Download sequence
Identical sequences A0A0D0IIQ5 A0A0H3PFA5 A0A110KCA5 A4NX93 A5UDT2 A5UHU6 E1XB96 P44347 Q4QMA6
gi|319775273|ref|YP_004137761.1| 281310.NTHI0956 374930.CGSHiEE_08100 374931.CGSHiGG_07465 71421.HI0793 gi|148826563|ref|YP_001291316.1| gi|148827982|ref|YP_001292735.1| gi|16272734|ref|NP_438952.1| gi|386266480|ref|YP_005829972.1| gi|378696993|ref|YP_005178951.1| NP_438952.1.63031 WP_005655593.1.101989 WP_005655593.1.10621 WP_005655593.1.12329 WP_005655593.1.12713 WP_005655593.1.13610 WP_005655593.1.15261 WP_005655593.1.17173 WP_005655593.1.17253 WP_005655593.1.17459 WP_005655593.1.20853 WP_005655593.1.23065 WP_005655593.1.23149 WP_005655593.1.23920 WP_005655593.1.25413 WP_005655593.1.25656 WP_005655593.1.26077 WP_005655593.1.26667 WP_005655593.1.27712 WP_005655593.1.28397 WP_005655593.1.32618 WP_005655593.1.32982 WP_005655593.1.34722 WP_005655593.1.34925 WP_005655593.1.37003 WP_005655593.1.3733 WP_005655593.1.37452 WP_005655593.1.38938 WP_005655593.1.38951 WP_005655593.1.39279 WP_005655593.1.40038 WP_005655593.1.40343 WP_005655593.1.40503 WP_005655593.1.40942 WP_005655593.1.42240 WP_005655593.1.42267 WP_005655593.1.42729 WP_005655593.1.43923 WP_005655593.1.44893 WP_005655593.1.45125 WP_005655593.1.4569 WP_005655593.1.46862 WP_005655593.1.50588 WP_005655593.1.50795 WP_005655593.1.52701 WP_005655593.1.5387 WP_005655593.1.53947 WP_005655593.1.54653 WP_005655593.1.55069 WP_005655593.1.56005 WP_005655593.1.56181 WP_005655593.1.57183 WP_005655593.1.57312 WP_005655593.1.59352 WP_005655593.1.59529 WP_005655593.1.6054 WP_005655593.1.61426 WP_005655593.1.61635 WP_005655593.1.62109 WP_005655593.1.62697 WP_005655593.1.6349 WP_005655593.1.63539 WP_005655593.1.64134 WP_005655593.1.67509 WP_005655593.1.68713 WP_005655593.1.71424 WP_005655593.1.74240 WP_005655593.1.74810 WP_005655593.1.75193 WP_005655593.1.75514 WP_005655593.1.75525 WP_005655593.1.76348 WP_005655593.1.76369 WP_005655593.1.76410 WP_005655593.1.76422 WP_005655593.1.76737 WP_005655593.1.78836 WP_005655593.1.79255 WP_005655593.1.79564 WP_005655593.1.79785 WP_005655593.1.80605 WP_005655593.1.82376 WP_005655593.1.82381 WP_005655593.1.85244 WP_005655593.1.85362 WP_005655593.1.8638 WP_005655593.1.86649 WP_005655593.1.8829 WP_005655593.1.88810 WP_005655593.1.90320 WP_005655593.1.90586 WP_005655593.1.91188 WP_005655593.1.91647 WP_005655593.1.91769 WP_005655593.1.92138 WP_005655593.1.92858 WP_005655593.1.93392 WP_005655593.1.93723 WP_005655593.1.94547 WP_005655593.1.94621 WP_005655593.1.9601 WP_005655593.1.96546 WP_005655593.1.9694 WP_005655593.1.9761 WP_005655593.1.97721 WP_005655593.1.98200 WP_005655593.1.99326 WP_005655593.1.99776 gi|68249389|ref|YP_248501.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]