SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|148827983|ref|YP_001292736.1| from Haemophilus influenzae PittGG

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|148827983|ref|YP_001292736.1|
Domain Number 1 Region: 3-115
Classification Level Classification E-value
Superfamily Translational machinery components 2.83e-50
Family Ribosomal protein L18 and S11 0.00000231
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|148827983|ref|YP_001292736.1|
Sequence length 117
Comment 50S ribosomal protein L18 [Haemophilus influenzae PittGG]
Sequence
MDKKSARIRRAARARHMMREQGVTRLVIHRTPRHIYAQVIAPNGSEVLAAASTVEKAIRE
QVKYTGNKDAAAAVGKAVAERALAKGVQAVAFDRSGFKYHGRVQTLADAAREAGLQF
Download sequence
Identical sequences A0A0D0HTB2 A0A0E1SRW8 A0A0H3PNY9 A0A0M3FXT2 A0A0Y0B638 A0A1B8QSV6 A4MWS8 A4N334 A4NX94 A5UDT1 A5UHU7 E1XB97 E7A6A6 F9GRF6 F9GVY3 F9GXC9 H1LQD1 P44356 Q4QMA5
NP_438953.1.63031 WP_005625873.1.101347 WP_005625873.1.101989 WP_005625873.1.1036 WP_005625873.1.10621 WP_005625873.1.1191 WP_005625873.1.12329 WP_005625873.1.12713 WP_005625873.1.13610 WP_005625873.1.14659 WP_005625873.1.15261 WP_005625873.1.17173 WP_005625873.1.17253 WP_005625873.1.17428 WP_005625873.1.17459 WP_005625873.1.18037 WP_005625873.1.20018 WP_005625873.1.20853 WP_005625873.1.23065 WP_005625873.1.23149 WP_005625873.1.23920 WP_005625873.1.25413 WP_005625873.1.25656 WP_005625873.1.26077 WP_005625873.1.26667 WP_005625873.1.27712 WP_005625873.1.28339 WP_005625873.1.28397 WP_005625873.1.29002 WP_005625873.1.32618 WP_005625873.1.32982 WP_005625873.1.34722 WP_005625873.1.34925 WP_005625873.1.36515 WP_005625873.1.37003 WP_005625873.1.3733 WP_005625873.1.37452 WP_005625873.1.38460 WP_005625873.1.38938 WP_005625873.1.38951 WP_005625873.1.39279 WP_005625873.1.40038 WP_005625873.1.40040 WP_005625873.1.40343 WP_005625873.1.40503 WP_005625873.1.40942 WP_005625873.1.41611 WP_005625873.1.42240 WP_005625873.1.42267 WP_005625873.1.42821 WP_005625873.1.43923 WP_005625873.1.44893 WP_005625873.1.45125 WP_005625873.1.4569 WP_005625873.1.46862 WP_005625873.1.47625 WP_005625873.1.50588 WP_005625873.1.50795 WP_005625873.1.51509 WP_005625873.1.51941 WP_005625873.1.52701 WP_005625873.1.5387 WP_005625873.1.53947 WP_005625873.1.54653 WP_005625873.1.55069 WP_005625873.1.56005 WP_005625873.1.56181 WP_005625873.1.57183 WP_005625873.1.57312 WP_005625873.1.59352 WP_005625873.1.59529 WP_005625873.1.6054 WP_005625873.1.61426 WP_005625873.1.61635 WP_005625873.1.62109 WP_005625873.1.62697 WP_005625873.1.63263 WP_005625873.1.6349 WP_005625873.1.63539 WP_005625873.1.64134 WP_005625873.1.67509 WP_005625873.1.68713 WP_005625873.1.69356 WP_005625873.1.71424 WP_005625873.1.74240 WP_005625873.1.74810 WP_005625873.1.75193 WP_005625873.1.75514 WP_005625873.1.75525 WP_005625873.1.76348 WP_005625873.1.76369 WP_005625873.1.76410 WP_005625873.1.76422 WP_005625873.1.76737 WP_005625873.1.78014 WP_005625873.1.78836 WP_005625873.1.79255 WP_005625873.1.79564 WP_005625873.1.79785 WP_005625873.1.80605 WP_005625873.1.82376 WP_005625873.1.82381 WP_005625873.1.85244 WP_005625873.1.85362 WP_005625873.1.86352 WP_005625873.1.8638 WP_005625873.1.86544 WP_005625873.1.86649 WP_005625873.1.87366 WP_005625873.1.87894 WP_005625873.1.8829 WP_005625873.1.88810 WP_005625873.1.90320 WP_005625873.1.90586 WP_005625873.1.91188 WP_005625873.1.91584 WP_005625873.1.91647 WP_005625873.1.91769 WP_005625873.1.92138 WP_005625873.1.92858 WP_005625873.1.93392 WP_005625873.1.93723 WP_005625873.1.94547 WP_005625873.1.94621 WP_005625873.1.9601 WP_005625873.1.96546 WP_005625873.1.9694 WP_005625873.1.9761 WP_005625873.1.97721 WP_005625873.1.98200 WP_005625873.1.99326 WP_005625873.1.99776 gi|16272735|ref|NP_438953.1| gi|386264767|ref|YP_005828260.1| gi|378696994|ref|YP_005178952.1| gi|68249390|ref|YP_248502.1| gi|386266479|ref|YP_005829971.1| 281310.NTHI0957 374930.CGSHiEE_08095 374931.CGSHiGG_07470 71421.HI0794 gi|148827983|ref|YP_001292736.1| gi|319897712|ref|YP_004135909.1| gi|148826562|ref|YP_001291315.1| gi|319775272|ref|YP_004137760.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]