SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|148827987|ref|YP_001292740.1| from Haemophilus influenzae PittGG

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|148827987|ref|YP_001292740.1|
Domain Number 1 Region: 15-422
Classification Level Classification E-value
Superfamily Preprotein translocase SecY subunit 3.4e-131
Family Preprotein translocase SecY subunit 0.0017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|148827987|ref|YP_001292740.1|
Sequence length 441
Comment preprotein translocase subunit SecY [Haemophilus influenzae PittGG]
Sequence
MAKQPGYQARSTNSGKGELKSRLLFVLGALIVYRIGSFIPVPGIDAAVLAQLVEQQKGTI
IDMFNMFSGGALSRASILALGIMPYISASIVIQLLATVSPALAELKKEGAAGQRKISKYT
RYATVVFATIQAVAISTGLPNMLSGLVPNVGFSFYFTSVVSLVTGTMFLMWLGEQITERG
IGNGISILVFGGIVAGLPSAILQTIEQARQGQMHPLVLLLIAAIVFAVTYFVVFVERGQR
RIRVEYAKRQQGRQILGGHSTHLPLKVNMANVMPAIFASSIILFPATLTQWFGQNDKFEW
LNNLSMLLNPGQPLYLLVYAVAIIFFSFFYTAMQYNPRDTADNLKKSGAFIPGIRPGEQT
SRYIDKVMTRLTLIGGLYVTFVCLVPYIMTSAWDVKFYFGGTSLLIVVVVIMDFIVQVQS
HLMSSQYESALKKANLKGFGQ
Download sequence
Identical sequences A0A0D0IIQ1 A0A0E1SQP7 A0A0E1WMM3 A0A0H3PFB0 A0A0Y0B6B2 A4N338 A5UHV1 E1XBA1 E7A6A2 P43804
gi|386266475|ref|YP_005829967.1| 374930.CGSHiEE_08075 374931.CGSHiGG_07490 71421.HI0798 gi|148827987|ref|YP_001292740.1| gi|319897708|ref|YP_004135905.1| gi|148826558|ref|YP_001291311.1| gi|386264763|ref|YP_005828256.1| NP_438957.1.63031 WP_005652382.1.101347 WP_005652382.1.101989 WP_005652382.1.1036 WP_005652382.1.12387 WP_005652382.1.12713 WP_005652382.1.13610 WP_005652382.1.15927 WP_005652382.1.17173 WP_005652382.1.17253 WP_005652382.1.17428 WP_005652382.1.20018 WP_005652382.1.20644 WP_005652382.1.25413 WP_005652382.1.26077 WP_005652382.1.26667 WP_005652382.1.28719 WP_005652382.1.32414 WP_005652382.1.32982 WP_005652382.1.34925 WP_005652382.1.3733 WP_005652382.1.37452 WP_005652382.1.38951 WP_005652382.1.40038 WP_005652382.1.40040 WP_005652382.1.40503 WP_005652382.1.42267 WP_005652382.1.42729 WP_005652382.1.42821 WP_005652382.1.45125 WP_005652382.1.48995 WP_005652382.1.51509 WP_005652382.1.52701 WP_005652382.1.54661 WP_005652382.1.55069 WP_005652382.1.56181 WP_005652382.1.57183 WP_005652382.1.57312 WP_005652382.1.58856 WP_005652382.1.6054 WP_005652382.1.61635 WP_005652382.1.62109 WP_005652382.1.63263 WP_005652382.1.6349 WP_005652382.1.68713 WP_005652382.1.71424 WP_005652382.1.74023 WP_005652382.1.75193 WP_005652382.1.76369 WP_005652382.1.76410 WP_005652382.1.76422 WP_005652382.1.76737 WP_005652382.1.78014 WP_005652382.1.79564 WP_005652382.1.80605 WP_005652382.1.82376 WP_005652382.1.85244 WP_005652382.1.85362 WP_005652382.1.8638 WP_005652382.1.86544 WP_005652382.1.86649 WP_005652382.1.87366 WP_005652382.1.87894 WP_005652382.1.88810 WP_005652382.1.90238 WP_005652382.1.91647 WP_005652382.1.93392 WP_005652382.1.93723 WP_005652382.1.94547 WP_005652382.1.94621 WP_005652382.1.94624 WP_005652382.1.9601 WP_005652382.1.96396 WP_005652382.1.96546 WP_005652382.1.9694 WP_005652382.1.9761 WP_005652382.1.97818 WP_005652382.1.98200 gi|378696998|ref|YP_005178956.1| gi|543951534|ref|YP_008543608.1| gi|16272739|ref|NP_438957.1| gi|319775268|ref|YP_004137756.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]