SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|148827991|ref|YP_001292744.1| from Haemophilus influenzae PittGG

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|148827991|ref|YP_001292744.1|
Domain Number 1 Region: 53-177
Classification Level Classification E-value
Superfamily Insert subdomain of RNA polymerase alpha subunit 3.66e-40
Family Insert subdomain of RNA polymerase alpha subunit 0.000000635
Further Details:      
 
Domain Number 2 Region: 7-53,178-232
Classification Level Classification E-value
Superfamily RBP11-like subunits of RNA polymerase 4.81e-30
Family RNA polymerase alpha subunit dimerisation domain 0.0000308
Further Details:      
 
Domain Number 3 Region: 250-324
Classification Level Classification E-value
Superfamily C-terminal domain of RNA polymerase alpha subunit 1.16e-25
Family C-terminal domain of RNA polymerase alpha subunit 0.00000999
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|148827991|ref|YP_001292744.1|
Sequence length 328
Comment DNA-directed RNA polymerase subunit alpha [Haemophilus influenzae PittGG]
Sequence
MQGSVTEFLKPRLVDIEQISSTHAKVILEPLERGFGHTLGNALRRILLSSMPGCAVTEVE
IDGVLHEYSSKEGVQEDILEVLLNLKGLAVKVQNKDDVILTLNKSGIGPVVAADITHDGD
VEIVNPDHVICHLTDENASISMRIRVQRGRGYVPASSRTHTQEERPIGRLLVDACYSPVE
RIAYNVEAARVEQRTDLDKLVIELETNGALEPEEAIRRAATILAEQLDAFVDLRDVRQPE
IKEEKPEFDPILLRPVDDLELTVRSANCLKAETIHYIGDLVQRTEVELLKTPNLGKKSLT
EIKDVLASRGLSLGMRLENWPPASIAED
Download sequence
Identical sequences A0A0E1SQP2 A0A110KCS9 A0A1Q5Y4M4 A4MWR8 A5UHV5 E1XBA6 Q4QM97
281310.NTHI0965 374931.CGSHiGG_07510 gi|148827991|ref|YP_001292744.1| gi|378697003|ref|YP_005178961.1| gi|68249398|ref|YP_248510.1| gi|386264758|ref|YP_005828251.1| WP_005648402.1.10621 WP_005648402.1.12329 WP_005648402.1.13610 WP_005648402.1.15261 WP_005648402.1.20018 WP_005648402.1.20853 WP_005648402.1.23065 WP_005648402.1.23149 WP_005648402.1.23920 WP_005648402.1.25656 WP_005648402.1.28397 WP_005648402.1.32982 WP_005648402.1.34722 WP_005648402.1.34925 WP_005648402.1.37452 WP_005648402.1.38938 WP_005648402.1.39279 WP_005648402.1.40040 WP_005648402.1.40343 WP_005648402.1.40503 WP_005648402.1.42267 WP_005648402.1.43923 WP_005648402.1.44893 WP_005648402.1.45125 WP_005648402.1.4569 WP_005648402.1.50588 WP_005648402.1.50795 WP_005648402.1.51509 WP_005648402.1.5387 WP_005648402.1.54653 WP_005648402.1.57312 WP_005648402.1.59352 WP_005648402.1.59529 WP_005648402.1.6054 WP_005648402.1.61426 WP_005648402.1.62697 WP_005648402.1.63539 WP_005648402.1.64134 WP_005648402.1.74240 WP_005648402.1.74810 WP_005648402.1.75193 WP_005648402.1.75514 WP_005648402.1.75525 WP_005648402.1.76348 WP_005648402.1.76737 WP_005648402.1.78014 WP_005648402.1.79255 WP_005648402.1.79564 WP_005648402.1.79785 WP_005648402.1.82376 WP_005648402.1.82381 WP_005648402.1.85362 WP_005648402.1.86649 WP_005648402.1.87366 WP_005648402.1.8829 WP_005648402.1.88810 WP_005648402.1.90320 WP_005648402.1.91188 WP_005648402.1.91769 WP_005648402.1.92858 WP_005648402.1.93392 WP_005648402.1.9761 WP_005648402.1.97721 WP_005648402.1.99326 WP_005648402.1.99776

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]