SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|148827993|ref|YP_001292746.1| from Haemophilus influenzae PittGG

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|148827993|ref|YP_001292746.1|
Domain Number 1 Region: 29-87
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 0.0000000816
Family CAP C-terminal domain-like 0.05
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|148827993|ref|YP_001292746.1|
Sequence length 88
Comment cAMP-binding protein - catabolite gene activator and regulatory subunit of cAMP-dependent protein kinase [Haemophilus influenzae PittGG]
Sequence
MLLLGKTSLKSTGYDEEHRISNTAYKRSYERIIDAIENLTESYPDYPWTYREVAEFCGCE
AETAIRISRELKKQGILDKNTRHLRICS
Download sequence
Identical sequences A5UHV7
374931.CGSHiGG_07520 WP_012055233.1.45125 WP_012055233.1.79564 gi|148827993|ref|YP_001292746.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]